DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cul6 and pcu4

Sequence 1:NP_648620.1 Gene:Cul6 FlyBaseID:FBgn0036332 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_594195.1 Gene:pcu4 PomBaseID:SPAC3A11.08 Length:734 Species:Schizosaccharomyces pombe

Alignment Length:757 Identity:164/758 (22%)
Similarity:303/758 (40%) Gaps:170/758 (22%)


  Fly     1 MNRVKRISNYFDSMLPLIDNILQVVNQIFDDYTSFDGQKLMHLYHLIYKQCAAERNWNNPAQKNG 65
            :.|..:.|..|:.:...:.:.:|::....:.:...:|.:.......:...|     ||...::  
pombe    60 LTRADQASRCFNILQHHMSSGIQLLKDSAESFIQLEGTETDTNACTVVVGC-----WNKWLER-- 117

  Fly    66 RSLYIVLSDCLMKRLKNIAWVMENQLDDNKPIRLIAKYLEHWVPYQRSCEKLNLACYHFNRNWVE 130
                       ::.::||.:.|:.            .:|.|...|. :.|:|:|:.:        
pombe   118 -----------VEIVQNIFYYMDK------------TFLSHHPDYP-TIEELSLSLF-------- 150

  Fly   131 RERLKGDKE-TYPIYRLAMISWKELVFEPSV--TILAAIRLILSQMPREYNKSLEYQVYQVLQSI 192
            ||:|...|. ..|.....:.|::.|....|.  ..|....|:|.:  .|...|:...:|.|:.| 
pombe   151 REKLMAVKNIQIPFLNSLLQSFENLHSSKSTDHAYLQDAMLMLHR--TEMYSSVFVPMYLVMLS- 212

  Fly   193 VELYANDKYQDVSLPSRIDKIFTEKVMDFYKSTTLHE---FQKIVVSNDYKDFKHFLRYACLAMP 254
                   ::.|.....:|.::..|:.:::..|:...|   .:|..:..|.|..:..:: .||...
pombe   213 -------RFYDTESSQKIQELPLEEYLEYAMSSLEREDAYVEKFDIVRDKKSIRETVQ-RCLITS 269

  Fly   255 EIENGT----QFKAILKR------YLAARLQ---ETRL--------------------SGKDYIQ 286
            .::..|    ||  |.||      .|.|.||   ||..                    |..|.: 
pombe   270 HLDTLTKGISQF--IEKRDAHSCKLLYALLQFNHETEYLIQPWSDCLVDVGFKLVNDESKDDTL- 331

  Fly   287 AFLGLCRGPLQRALRDHTKLAEVVD-AVCKEE-------------IN-RKG-QIIDPTRLLVTYA 335
                     :|..|..|..|..||| :...:|             || .|| |...|.||:..|.
pombe   332 ---------VQELLSFHKFLQVVVDESFLHDETLSYAMRKAFETFINGAKGSQREAPARLIAKYI 387

  Fly   336 NELMTKRQESE--EAIIDELKRIVKCVEFLSDEYKFIDMYLKALRIRQINETSTSDGVESIMYSL 398
            :.|:...:::.  :.:.:....|:....:::.:..|...|...:..|.:...|.|...|.::..:
pombe   388 DYLLRVGEQASGGKPLKEVFSEILDLFRYIASKDIFEAYYKLDIAKRLLLNKSASAQNELMLLDM 452

  Fly   399 LNKKMANFVTRCIYVQLRDVDKLRTLKKEFQDHLNSKGIKLGFDFRPKCFKND------GSFENF 457
            |.|...:..|..:....|||:    :.|||.......  |...:.....:.|.      .|:...
pombe   453 LKKTCGSQFTHSLEGMFRDVN----ISKEFTSSFRHS--KAAHNLHRDLYVNVLSQAYWPSYPES 511

  Fly   458 NLTLPDELQQAWKEFRIFYEARKLQSK---------AIIQLNNELSSGEITCHLNQSVYILEVST 513
            ::.|||::||....|..||.::::..|         .|::....|.:.|           |.:|.
pombe   512 HIRLPDDMQQDLDCFEKFYLSKQVGKKISWYASLGHCIVKARFPLGNKE-----------LSISL 565

  Fly   514 LQMAVLMLFNR---HERFTEQEL--VTALG-VEL-ETLQE-ALKQIKFLVYIEVNKV----NYIE 566
            .|..||:.||.   .|..:.|:|  .|.|. ::| .|||. :..:|:.||.:..:|.    ....
pombe   566 FQACVLLQFNNCLGGEGISYQDLKKSTELSDIDLTRTLQSLSCARIRPLVMVPKSKKPSPDTMFY 630

  Fly   567 INMDFTNRKRRLFCNEPLPRKMRKIEEKSEIELKIRRDKQ--VDAAIVRIMKGQKQLEYSELISL 629
            :|..||::..|:..|:...::.|  :|.|:::.::.||:|  :.|:|||:||.::::::.:|:..
pombe   631 VNEKFTDKLYRVKINQIYLKEER--QENSDVQEQVVRDRQFELQASIVRVMKQKEKMKHDDLVQY 693

  Fly   630 VYEELKDRVKPQVSFIKKRLDYLVEREYLER-DNYYNIYRYL 670
            |...:|||..|.||.:|..::.|:|:||||| ||  :||.|:
pombe   694 VINNVKDRGIPLVSDVKTAIEKLLEKEYLEREDN--DIYTYV 733

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cul6NP_648620.1 COG5647 25..670 CDD:227934 160/732 (22%)
CULLIN 362..500 CDD:214545 30/153 (20%)
Cullin_Nedd8 606..661 CDD:287520 23/58 (40%)
pcu4NP_594195.1 COG5647 1..734 CDD:227934 164/758 (22%)
CULLIN 416..554 CDD:214545 28/144 (19%)
Cullin_Nedd8 663..730 CDD:214883 28/69 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11932
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.