DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cul6 and cul3

Sequence 1:NP_648620.1 Gene:Cul6 FlyBaseID:FBgn0036332 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_592949.1 Gene:cul3 PomBaseID:SPAC24H6.03 Length:785 Species:Schizosaccharomyces pombe

Alignment Length:795 Identity:168/796 (21%)
Similarity:286/796 (36%) Gaps:183/796 (23%)


  Fly    21 ILQ-VVNQIFDDYTSFDGQKLMHLYHLIYKQCAAERNWNNP----AQKNGRSLYIVLSDCLMKRL 80
            :|| .:..||...||               |.:.|..:.|.    ..|.|..||..:.|.:..||
pombe    28 VLQRAIGDIFQKSTS---------------QLSFEELYRNAYILVLHKYGEKLYNHVQDVIRSRL 77

  Fly    81 KN----------IAWVMENQLDDNKPIRLIAKYLEHWVPYQRSCEKLNLACYHFNRNW----VER 131
            |.          .|.::.|.|.|   ||....|...|   .||.|..:........:|    |..
pombe    78 KEETVPAIYKNYDASLLGNALLD---IRKNDSYSTSW---SRSLEAAHRFLSSLVNSWKDHIVSM 136

  Fly   132 ERLKG-----DK------ETYPIYRLAMISWKELVFEPSV--------TILAAIRL--------- 168
            :.:..     ||      :..|:....:..::|:|...|.        |||..:.|         
pombe   137 QMISSVLKYLDKVYSKSADKVPVNENGIYIFREVVLLNSFEIGEKCVETILILVYLERKGNTINR 201

  Fly   169 --------ILSQMPREYNKSLEYQV-------------YQVLQSIV------------------- 193
                    :|:.:|.|..|...|.|             |::..|.|                   
pombe   202 PLINDCLDMLNSLPSENKKETLYDVLFAPKFLSYTRNFYEIESSTVIGVFGVVEYLKKAEKRFEE 266

  Fly   194 ELYANDKYQDVSLPSRI-----DKIFTEKVMDFYKSTTLHEFQKIVVSN------DYKDFKHFLR 247
            |...:..|....:.|.:     |::.::.:.|..::.:...|..|..||      .|:.|.    
pombe   267 EKERSKNYLFTKIASPLLSVVEDELLSKHLDDLLENQSTGFFSMIDSSNFEGLQLVYESFS---- 327

  Fly   248 YACLAMPEIENGTQFKAILKRYLAARL-QETRLSGKDYIQAFLG-LCRGPL-----------QRA 299
                   .:|.|.:   .||:|||..: ...:|..:...||..| :..|.|           |:.
pombe   328 -------RVELGVK---SLKKYLAKYVAHHGKLINETTSQALEGKMAVGRLSSNATMATLWVQKV 382

  Fly   300 LRDHTKLAEVVDAVCKEEINRKGQIIDPTRLLV---TYANELMT----------KRQESEEAIID 351
            |....:|..::......:.:....:.|.....|   |.|.|.::          .|:..|.:|..
pombe   383 LALWDRLNTIISTTMDADRSILNSLSDAFVTFVDGYTRAPEYISLFIDDNLKKDARKAIEGSIEA 447

  Fly   352 ELKRIVKCVEFLSDEYKFIDMYLKALRIRQINETSTSDGVESIMYSLLNKKMANFVTRCIYVQLR 416
            .|:..|....|:|::..|...|...|..|.:|..|.|...|..|.|.|.::..|..|:.:.....
pombe   448 TLQNSVTLFRFISEKDVFEKYYKTHLAKRLLNNRSISSDAELGMISRLKQEAGNVFTQKLEGMFN 512

  Fly   417 DVDKLRTLKKEFQDHLNSKGIKLGFDFRPKCFKN-----DGSFENFNLTLPDELQQAWKEFRIFY 476
            |::..:.|.:|::.:...:..|...|.......:     |.|........|..|.....:|..||
pombe   513 DMNLSQELLQEYKHNSALQSAKPALDLNVSILASTFWPIDLSPHKIKCNFPKVLLAQIDQFTDFY 577

  Fly   477 EARKLQSKAIIQLNNELSSGEITCHLNQSVYILEVSTLQMAVLMLF---NRHERFTEQELVTALG 538
            .::....|.:  ....:.|.::..:.....|.|.|||:...:|:||   ..::....:|::....
pombe   578 LSKHTGRKLL--WYPSMGSADVRVNFKDRKYDLNVSTIASVILLLFQDLKENQCLIFEEILEKTN 640

  Fly   539 VELETLQEALKQI---KFLVYI------EVNKVNYIEINMDFTNRKRRLFCNEPLPRKMRKIEEK 594
            :|:..|:..|:.:   |:.:.:      |||..:....|.:|.:...|:..:.....::....|:
pombe   641 IEVGDLKRNLQSLACAKYKILLKDPKGREVNAGDKFYFNENFVSNLARIKISTVAQTRVEDDSER 705

  Fly   595 SEIELKI--RRDKQVDAAIVRIMKGQKQLEYSELISLVYEELKDRVKPQVSFIKKRLDYLVEREY 657
            .....|:  .|..|.||.|||:||.:|..|:::|::.|..:|..|..|....||:|::.|:||||
pombe   706 KRTLEKVDESRKHQADACIVRVMKDRKVCEHNQLMAEVTRQLNPRFHPSPMMIKRRIEALIEREY 770

  Fly   658 LER--DNYYNIYRYL 670
            |:|  || ..||.||
pombe   771 LQRQADN-GRIYEYL 784

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cul6NP_648620.1 COG5647 25..670 CDD:227934 165/789 (21%)
CULLIN 362..500 CDD:214545 29/143 (20%)
Cullin_Nedd8 606..661 CDD:287520 25/57 (44%)
cul3NP_592949.1 COG5647 1..785 CDD:227934 168/796 (21%)
CULLIN 458..601 CDD:214545 29/145 (20%)
Cullin_Nedd8 717..777 CDD:287520 26/60 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11932
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.