DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cul6 and cul1

Sequence 1:NP_648620.1 Gene:Cul6 FlyBaseID:FBgn0036332 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_594259.1 Gene:cul1 PomBaseID:SPAC17G6.12 Length:767 Species:Schizosaccharomyces pombe

Alignment Length:786 Identity:191/787 (24%)
Similarity:325/787 (41%) Gaps:166/787 (21%)


  Fly    11 FDSMLPLIDNILQVVNQIFDDYTSFDGQ---KLMHLYHLIYKQCA-AER-----NWNN-PAQKNG 65
            :||:....|.:...|:|||:...  :|.   |.|.||..|:..|| |.:     |:|: .|...|
pombe    17 YDSLNGTWDFLKTGVSQIFERLD--EGMTITKYMELYTAIHNYCADASKTITVDNFNDQTANVLG 79

  Fly    66 RSLY---IVLSDCLMKRLKNIAWVMENQLDDNKPIRLIAKYLEHWVPYQRSCEKLNLACYHFNRN 127
            .:||   ::..:..:.||:.......|..:.      :|.|.::|..:..|...:|....:.||.
pombe    80 EALYNNLVLYLEEYLARLRKECISQTNHEEQ------LAAYAKYWTRFTTSARFINHLFGYLNRY 138

  Fly   128 WVERERLKGDKETYPIYRLAMISW---------------------KELVFEP-----------SV 160
            ||:.:....:...|.||.|.::||                     |:.::||           |:
pombe   139 WVKLKNRFTETLVYDIYTLCLVSWHHHVFSHIRDSLLQNLLYMFTKKRLYEPTDMKYVEVCVDSI 203

  Fly   161 TILA---------------------------------AIRLILSQMPREYNKSLEYQVYQVLQSI 192
            |.|:                                 :...:.|....:|.|..|.::.:. :.:
pombe   204 TSLSFDKTDMTKPNLSSYKTFFETNFIENTKNFYAKESSEYLASHSITDYLKKAEIRLAEE-EEL 267

  Fly   193 VELYANDKYQDVSLPSRIDKIFTEKVMDFYKSTTLH-EFQKIVVSNDYKDFKHFLRYACLAMPEI 256
            |.||.::......|.:      ||.|:.......|| :|.:::..|..:|.....|    .|...
pombe   268 VRLYLHESTLKPLLEA------TEDVLIAQHEEVLHNDFARMLDQNCSEDIIRMYR----LMSRT 322

  Fly   257 ENGTQ-----FKAILKRYLAARLQ--------ETRLSGKDYIQAFLGLCRGP---LQRALRDHTK 305
            .||.|     |:..:||...|.:.        |..:..|:|::..|...:..   :..|....|.
pombe   323 PNGLQPLRQTFEEFVKRSGFAAVAKIVPQVGGEADVDPKEYMEMLLSTYKASKELVNTAFHGDTD 387

  Fly   306 LAEVVDAVCKEEINR-----KGQIIDPTRLLVTYANELMTKRQESEEA--IIDELKRIVKCVEFL 363
            ..:.:|...:|.:||     :.....| .||..||:.::.|..::.:.  :.|.|..|:....::
pombe   388 FTKSLDTAFRELVNRNVVCQRSSSRSP-ELLAKYADSILRKSNKNVDIDDVEDCLSSIIIIFRYV 451

  Fly   364 SDEYKFIDMYLKALRIRQINETSTSDGVESIMYSLLNKKMANF-VTRCIYVQLRDVDKLRTLKKE 427
            .|:..|.:.|.|.|..|.:|.||.|...||.|.|.| |::..| .|..:....:|:...:.:.:.
pombe   452 EDKDVFQNFYTKLLAKRLVNGTSNSQDAESSMLSKL-KEVCGFEYTSKLQRMFQDISLSQEITEA 515

  Fly   428 F-------QDHLNSKGIKLGFDFRPKCFKNDGSFENFNLTLPDELQQAWKEFRIFY----EARKL 481
            |       ..:::...:.||..|.|.      |..|.|..||:||...::.|:.:|    ..|||
pombe   516 FWQLPQSRAGNIDFSALVLGTSFWPL------SPNNVNFHLPEELVPLYEGFQNYYYSCHNGRKL 574

  Fly   482 QSKAIIQLNNELSSGEITCHLNQS---VYILEVSTLQMAVLMLFNRHERFTEQELVTALGVELET 543
            ....      .||.|||...:|..   .|:.:|||.||.||:|:|..:.:|.:||....|:..:.
pombe   575 SWLF------HLSKGEIKARINPQTNVTYVFQVSTYQMGVLLLYNHRDSYTYEELAKITGLSTDF 633

  Fly   544 LQEALK---QIKFLVYIEVNKV----NYIEINMDFTNRKRRLFCNEPLPRKMRKIEEKSEIELKI 601
            |...|.   :.|.|:..:.:|:    :..:||.:|..:|.|:..|  ||.:..:.:|..|....|
pombe   634 LTGILNIFLKAKVLLLGDNDKLGDPNSTYKINENFRMKKIRVQLN--LPIRSEQKQESLETHKTI 696

  Fly   602 RRDKQ--VDAAIVRIMKGQKQLEYSELISLVYEELKDRVKPQVSFIKKRLDYLVEREYLE---RD 661
            ..|::  :.:|||||||.::.|::..|:....:::|.|..|:||.||:.:|.|:|:||||   ||
pombe   697 EEDRKLLLQSAIVRIMKARRTLKHVVLVKETIDQIKSRFTPKVSDIKQCIDMLIEKEYLERQGRD 761

  Fly   662 NYYNIY 667
            .|  ||
pombe   762 EY--IY 765

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cul6NP_648620.1 COG5647 25..670 CDD:227934 188/773 (24%)
CULLIN 362..500 CDD:214545 41/150 (27%)
Cullin_Nedd8 606..661 CDD:287520 24/60 (40%)
cul1NP_594259.1 COG5647 1..767 CDD:227934 191/787 (24%)
CULLIN 450..589 CDD:214545 41/152 (27%)
Cullin_Nedd8 696..763 CDD:214883 27/67 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11932
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
22.060

Return to query results.
Submit another query.