DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cul6 and cul-3

Sequence 1:NP_648620.1 Gene:Cul6 FlyBaseID:FBgn0036332 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_503151.1 Gene:cul-3 WormBaseID:WBGene00000838 Length:777 Species:Caenorhabditis elegans

Alignment Length:802 Identity:165/803 (21%)
Similarity:309/803 (38%) Gaps:192/803 (24%)


  Fly    10 YFDSMLPLIDNILQVVNQIFDDYTSFDGQKLMHLYHLIYKQCAAERNWNNPAQKNGRSLYIVLSD 74
            |......|:...:|.:.:..:...||:     .||...|...         ..|:|..||..|.|
 Worm    26 YVTQTWELLKRAIQEIQRKNNSGLSFE-----ELYRNAYTMV---------LHKHGERLYNGLKD 76

  Fly    75 CLMKRLKNIAWVMENQLDDNKPIRLIAKYLEHWVPYQRSCEKLNLACYHFNRNWVERERLKGDKE 139
            .:...:.::...:...::....:..:|   |.|..:..:...:.....:.:|.:|.:     :..
 Worm    77 VIQDHMASVRIRIIESMNSGSFLETVA---ESWADHTVAMVMIRDILMYMDRIYVAQ-----NNH 133

  Fly   140 TYPIYRLAMISWK-ELVFEPSV--TILAAIRLILSQMPREYNKSLEYQVYQVLQSIVELYANDK- 200
            ..|:|.|.:.::: |::.:..:  .|..|: |.|.::.|:.|:...:.:......::.|..:.: 
 Worm   134 VLPVYNLGLDAYRTEILRQNGIGDRIRDAL-LELIKLDRKSNQINWHGIKNACDMLISLGIDSRT 197

  Fly   201 -YQDVSLPSRIDKIFTEKVMDFYKSTTLHEFQKIVVSNDYKDFKHFLRYACLAMPEIENGTQFKA 264
             |:|     ..::...::..|:|:...     |..:|.|        ..||..:.::|.....:|
 Worm   198 VYED-----EFERPLLKETSDYYRDVC-----KNWLSGD--------NDACFYLAQVEIAMHDEA 244

  Fly   265 I-LKRYLAARLQETRLSGKD------YIQAFLGLCRGPLQRALRDHTKLAEVV----------DA 312
            . ..|||....:...|...|      :||..:.:..|.::..| :|.|:.::.          |:
 Worm   245 SRASRYLDKMTEAKILQVMDDVMVAEHIQTIVYMQNGGVKFML-EHKKIEDLTRIFRIFKRIGDS 308

  Fly   313 V-------------CKEEINRKG-QIIDPTRLL---VTYANELM--------------------- 339
            |             ..|.:|..| .|:....||   |.:.|||:                     
 Worm   309 VTVPGGGLKALLKAVSEYLNETGSNIVKNEDLLKNPVNFVNELLQLKDYFSSLLTTAFADDRDFK 373

  Fly   340 ------------TKRQESEEAII---DELKRIVKCV----------------EFLSDEYKFIDMY 373
                        :.||..|...:   |.|:..:|||                .:|.::..|...:
 Worm   374 NRFQHDFETFLNSNRQSPEFVALYMDDMLRSGLKCVSDAEMDNKLDNVMILFRYLQEKDVFEKYF 438

  Fly   374 LKALRIRQINETSTSDGVESIMYSLLNKKMANFVTRCIYVQLRDVDKLRTLKKEFQDHLNSKGIK 438
            .:.|..|.:.:.|.||.||..:.:.|..:.....|:.:....||.:...||...|:|...::..|
 Worm   439 KQYLAKRLLLDKSCSDDVEKALLAKLKTECGCQFTQKLENMFRDKELWLTLATSFRDWREAQPTK 503

  Fly   439 LGFDFRPKCFKNDGSFENFN---LTLPDELQQAWKEFRIFY----EARKLQSKAII--------- 487
            :..|...:.. ..|.:....   :.||.||..|::.|..:|    ..|||....::         
 Worm   504 MSIDISLRVL-TAGVWPTVQCNPVVLPQELSVAYEMFTQYYTEKHTGRKLTINTLLGNADVKATF 567

  Fly   488 ------QLNNE------LSSGEITCHLNQSVYILEVSTLQMAVLMLFNRHERFTEQELVTALGVE 540
                  .::||      .||||..........||:|:|.||.:|:.||.|.|.:.|:|:..|.:.
 Worm   568 YPPPKASMSNEENGPGPSSSGESMKERKPEHKILQVNTHQMIILLQFNHHNRISCQQLMDELKIP 632

  Fly   541 LETLQEALKQIKF-----LVYIEVNK-------VNYIEINMDFTNRKRRLFCNEPLPRKMRKIEE 593
            ...|:..|:.:..     .:.:..||       .:...:|.:|.::..|:        |::.:..
 Worm   633 ERELKRNLQSLALGKASQRILVRKNKGKDAIDMSDEFAVNDNFQSKLTRV--------KVQMVTG 689

  Fly   594 KSEIELKIRRDKQ---------VDAAIVRIMKGQKQLEYSELISLVYEELKDRVKPQVSFIKKRL 649
            |.|.|.:||..:|         |:||||||||.:|:|.::.|::.|.::|:.|..|....||:|:
 Worm   690 KVESEPEIRETRQKVEDDRKLEVEAAIVRIMKARKKLNHNNLVAEVTQQLRHRFMPSPIIIKQRI 754

  Fly   650 DYLVEREYLERDNY-YNIYRYL 670
            :.|:|||||.||.: :..|:|:
 Worm   755 ETLIEREYLARDEHDHRAYQYI 776

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cul6NP_648620.1 COG5647 25..670 CDD:227934 162/786 (21%)
CULLIN 362..500 CDD:214545 36/166 (22%)
Cullin_Nedd8 606..661 CDD:287520 27/64 (42%)
cul-3NP_503151.1 Cullin 32..674 CDD:279260 126/685 (18%)
CULLIN 427..567 CDD:214545 30/141 (21%)
Cullin_Nedd8 709..769 CDD:287520 27/60 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1040292at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.