DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cul6 and cul-6

Sequence 1:NP_648620.1 Gene:Cul6 FlyBaseID:FBgn0036332 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_502412.1 Gene:cul-6 WormBaseID:WBGene00000841 Length:729 Species:Caenorhabditis elegans

Alignment Length:735 Identity:174/736 (24%)
Similarity:299/736 (41%) Gaps:140/736 (19%)


  Fly    41 MHLYHLIYKQCA----AERNWNNPAQKNGRSLYIVLSDCLMKRLKN------IAWVMENQLDDNK 95
            |.||..:|..|.    |..|.|:|.         ..|:.|.|:|:|      ||  :.:::....
 Worm    29 MMLYDAVYNICTTTTLANSNNNSPE---------FASEFLYKQLENYIRTYVIA--IRDRISACS 82

  Fly    96 PIRLIAKYLEHWVPYQRSCEKLNLACYHFNRNWVERERLKGDKETYPIYRLAMISWKELVFE--P 158
            ...|:.|....|..::.|....|....:.|||:|.::....:.|...||:||:..||...|:  .
 Worm    83 GDELLGKCTIEWDNFKFSTRICNCIFQYLNRNFVSKKVEDKNGEIVEIYKLALDIWKAEFFDNFK 147

  Fly   159 SVTILAAIRLILSQMPREYNKSLEYQVYQVLQSIVELYANDKYQDVSLPSRID--KIF------- 214
            ..||.|.:.|||  :.|..:......:..|::.:.||   |.|:....|..:|  |:|       
 Worm   148 VKTIDAILELIL--LERCGSTINSTHISSVVECLTEL---DIYKVSFEPQFLDATKLFYKQEVLN 207

  Fly   215 -TEKVMDF------------YKS----------TTLHEFQKIVVSNDYKDFKHFLRYACLAMPEI 256
             .|.|:::            |:|          ..:...:.|::|:..| |.|......|...:.
 Worm   208 SKETVIEYMITVENRLFQEEYRSRRYLGPSTNDLLIDSCESILISDRLK-FLHSEFERLLEARKD 271

  Fly   257 ENGTQFKAILKR----------YLAARL----QET----------RLSGKDYIQAFL-------- 289
            |:.|:..::.:|          ||..|:    .||          :.:.|:||...|        
 Worm   272 EHLTRMYSLCRRVTHGLEDLRVYLEKRILKEGHETLQRLAKDSGLKTTPKEYITKLLEVHEIYFN 336

  Fly   290 ---------GLCRGPLQRALRDHTKLAEVVDAVCKEEINRKGQIIDPTRLLVTYANELMTKRQE- 344
                     .|....|.:|.:|..: |..|..:..|: :|..:..|   .|..|.::|:.|..: 
 Worm   337 LINKAFDRNALFMQSLDKASKDFIE-ANAVTMLAPEK-HRSTRSAD---YLARYCDQLLKKNSKV 396

  Fly   345 SEEAIIDELKRIVKCVEFLSDEYKFIDMYLKALRIRQINETSTSDGVESIMYSLLNKKMANFVTR 409
            .:|..:|:...::|   ::|::..|...|......|.||.:|.||..|....:.|........||
 Worm   397 QDETALDKALTVLK---YISEKDVFQLYYQNWFSERIINNSSASDDAEEKFITNLTATEGLEYTR 458

  Fly   410 CIYVQLRDVDKLRTLKKEFQDHLNSKGIKLGFDFRPKCFKNDG---SFENFNLTLPDELQQAWKE 471
            .:...:.|....:.|..||:|....|.|    ||. ...:..|   |.:...:.||.||....||
 Worm   459 NLVKMVEDAKISKDLTTEFKDIKTEKSI----DFN-VILQTTGAWPSLDQIKIILPRELSTILKE 518

  Fly   472 FRIFYEARKLQSKAIIQLNNELSS--GEITCHLNQSVYILEVSTLQMAVLMLFNRHERFTEQELV 534
            |..||.|    |....:||...|.  ||:.....:..|:..|:..|:..|.|||..:.||.:::.
 Worm   519 FDTFYNA----SHNGRRLNWAYSQCRGEVNSKAFEKKYVFIVTASQLCTLYLFNEQDSFTIEQIS 579

  Fly   535 TALGVELETLQEALKQIKFLV--YIEVNKVN---------YIEINMDFTNRKRRLFCNEPLPRKM 588
            .|:.:..::....:..:..::  .:.|:|.|         .:.:|..:.|:|.|:.....: :|.
 Worm   580 KAIEMTAKSTSAIVGSLNPVIDPVLVVDKGNEKDGYPPDAVVSLNTKYANKKVRVDLTTAI-KKA 643

  Fly   589 RKIEEKSEIELKIRRDK--QVDAAIVRIMKGQKQLEYSELISLVYEELKDRVKPQVSFIKKRLDY 651
            ....|...::..:..|:  ::.|.||||||.:|.|.::.||:.:..:||.|..|.|..||..::.
 Worm   644 TADRETDAVQNTVESDRKYEIKACIVRIMKTRKSLTHTLLINEIISQLKSRFTPNVQMIKICIEI 708

  Fly   652 LVEREYLER-DNYYNIYRYL 670
            |:|:.|:.| :|.:|:|.||
 Worm   709 LIEQLYIRRSENEHNVYEYL 728

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cul6NP_648620.1 COG5647 25..670 CDD:227934 173/734 (24%)
CULLIN 362..500 CDD:214545 40/143 (28%)
Cullin_Nedd8 606..661 CDD:287520 22/56 (39%)
cul-6NP_502412.1 Cullin 10..596 CDD:279260 137/601 (23%)
CULLIN 411..547 CDD:214545 40/145 (28%)
Cullin_Nedd8 656..723 CDD:214883 24/67 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S1033
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1040292at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11932
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.920

Return to query results.
Submit another query.