DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cul6 and cul-2

Sequence 1:NP_648620.1 Gene:Cul6 FlyBaseID:FBgn0036332 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_001023008.1 Gene:cul-2 WormBaseID:WBGene00000837 Length:791 Species:Caenorhabditis elegans

Alignment Length:797 Identity:162/798 (20%)
Similarity:313/798 (39%) Gaps:171/798 (21%)


  Fly    11 FDSM-LPLIDNILQVVNQIFDDYTSFDGQKLMHLYHLIYKQCAAERNWNNPAQKNGRSLYIVLSD 74
            ||.: :.|..:|:.::|     .......:..|.:..:|..|.     :.|...:.| ||..:..
 Worm    28 FDKVWVQLRPSIIDIIN-----LRPITNVQWHHKFSDVYDICV-----SIPTPLSER-LYNEVKA 81

  Fly    75 CLMKRLKNIAWVMENQLDDNKPIRLIAKYLEHWVPYQRSCEKLNLACYHFNRNWVERERLKGDKE 139
            |:.:.::.    ....:.|..|..|:.:|.:.|..:......::....:.|:.:|:::|.. |.:
 Worm    82 CIQEHVRQ----KRQDIVDVDPDLLLQEYHKMWRVFHEGAIFIHRLFGYLNKQFVKQKRCT-DLD 141

  Fly   140 TYPIYR-------------LAMISWKELVFEPSVTILAAIRLILSQMPREYN-KSLEYQVYQVLQ 190
            .:..|.             ||:..|||.:.:..:..|..:.||.....|:.| ..:..:|..|:.
 Worm   142 NFAQYAAFLQIPDVKEIGCLALEIWKEDLVKTILPQLVKLLLIAIDNDRKGNFPHIANEVSGVIN 206

  Fly   191 SIVELYAND---------KYQ----------------------------------DVSL------ 206
            |.|::...|         :|:                                  |:|.      
 Worm   207 SFVKMEETDFDVVPAEGARYKARESTTAFYQESFEKPLLTDTEQYYSALAQKMLTDLSCSEYMEQ 271

  Fly   207 -----------------PSRIDKIFT--EKVMDFYKSTTLHEF-QKIVVSNDYKDFKHFLRYACL 251
                             .|.::|:.|  :|||.......||.. ..::.:.:.||.::..|   |
 Worm   272 VIVLLEQEEMRAKKYLHESSVEKVITLCQKVMIKAHKDKLHAVCHDLITNEENKDLRNMYR---L 333

  Fly   252 AMPEIENG-----TQFKA-ILKRYLAARLQETRLSGKDYIQAFLGLCRGPLQRALRDHTKLAEVV 310
            ..| |:.|     .:|:. :.|:.|.|   .:||:|::..|.|       ::..||.:.|..::.
 Worm   334 LKP-IQAGLSVMVKEFEEYVKKKGLEA---VSRLTGENVPQQF-------VENVLRVYNKFNDMK 387

  Fly   311 DAVCKEE--------------INRK--GQII-DPTRLLVTYANELMTKRQE--SEEAIIDELKRI 356
            .||..::              :|.|  ||.: ..:..|..|.:.|:.|..:  ||..:..:|...
 Worm   388 TAVFMDDGEFSSGLDKALQGVVNSKEPGQSVPKASERLARYTDGLLKKSTKGLSETDLEAKLDSA 452

  Fly   357 VKCVEFLSDEYKFIDMYLKALRIRQINETSTSDGVESIMYSLLNKKMANFVTRCIYVQLRDVDKL 421
            :....::.|:..|...|.|.|..|.|..||.|...|.:|.:.|.:......|..:.....|:...
 Worm   453 IVIFRYIEDKDIFQKFYSKMLANRLIASTSISMDAEELMINKLKQACGYEFTSKLSRMFTDIGLS 517

  Fly   422 RTLKKEFQDHL-NSKGIKLGFDFRP-------------------KCFKNDGSFENFNLTLPDELQ 466
            :.|...|..|: :.|.::....|.|                   ....|..:.:..|..||..||
 Worm   518 QELSNNFDKHIADIKTVQPDVKFVPTQTMILQAGSWPLNAPQLSTNSNNQTAQDVANFHLPRILQ 582

  Fly   467 QAWKEFRIFYEARKLQSKAIIQLNNELSSGEITCHLNQSVYILEVSTLQMAVLMLFNRHERFTEQ 531
            ...:||..||.. |...:.:..|.| :|.|::........|:.::...|||.|:.|.|.:....:
 Worm   583 PVIQEFEKFYTG-KHNGRKLTWLFN-MSQGDVRLTYLDKQYVAQMYVYQMAALLCFERRDAILVK 645

  Fly   532 ELVTALGVELETLQEALKQIKFLVYIEVNKVN-----YIEINMDFTNRKRRLFCNEPLPRKMRKI 591
            ::...:||..:.|.:.::.|..:..:..:..|     .:.:||..|:::.:.....|...|  .:
 Worm   646 DIGEEIGVSGDYLLKTIRTILDVTLLTCDDQNLTADSLVRLNMSMTSKRMKFRLQAPQVNK--AV 708

  Fly   592 EEKSE-IELKIRRDKQ--VDAAIVRIMKGQKQLEYSELISLVYEELKDRVKPQVSFIKKRLDYLV 653
            |::.| :...:.:|::  ::.|||||||.:|.|:::.|::.:.::.|.|..|.|.||||.::.|:
 Worm   709 EKEQEAVANTVSQDRKYYMECAIVRIMKTRKVLKHNALVTEIMDQTKGRFSPDVPFIKKSIEDLI 773

  Fly   654 EREYLERDNYYNIYRYL 670
            |:.|::|.:..:.|:||
 Worm   774 EKMYIQRTDQNDEYQYL 790

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cul6NP_648620.1 COG5647 25..670 CDD:227934 157/781 (20%)
CULLIN 362..500 CDD:214545 36/158 (23%)
Cullin_Nedd8 606..661 CDD:287520 22/57 (39%)
cul-2NP_001023008.1 Cullin 34..662 CDD:279260 125/660 (19%)
CULLIN 458..616 CDD:214545 36/160 (23%)
Cullin_Nedd8 719..784 CDD:214883 23/65 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1040292at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.