DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cul6 and cul-1

Sequence 1:NP_648620.1 Gene:Cul6 FlyBaseID:FBgn0036332 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_499309.1 Gene:cul-1 WormBaseID:WBGene00000836 Length:780 Species:Caenorhabditis elegans

Alignment Length:694 Identity:153/695 (22%)
Similarity:284/695 (41%) Gaps:147/695 (21%)


  Fly    99 LIAKYLEHWVPYQRSCEKLNLACYHFNRNWVERERLKGDKETYPIYRLAMISWKELVFE--PSVT 161
            |:..|...|..::.|.:.::....:.||:|:.||..:|.:..|.:|.||::.||..:|.  ....
 Worm   111 LLKYYTTEWENFRISSKVMDGIFAYLNRHWIRRELDEGHENIYMVYTLALVVWKRNLFNDLKDKV 175

  Fly   162 ILAAIRLILSQMPREYNKSLEYQVYQVLQSIVELYANDKYQDVSLPSRIDKI----------FTE 216
            |.|.:.||.|:.......| .| :..|::.:|||..:|...|....:...|:          |.|
 Worm   176 IDAMLELIRSERTGSMINS-RY-ISGVVECLVELGVDDSETDAKKDAETKKLAVYKEFFEVKFLE 238

  Fly   217 KVMDFYK--------------------STTLHE--------------------FQKIVVSNDYKD 241
            ....||.                    .|.|::                    .:.:::||.. |
 Worm   239 ATRGFYTQEAANFLSNGGNVTDYMIKVETRLNQEDDRCQLYLNSSTKTPLATCCESVLISNQL-D 302

  Fly   242 F--KHF--------------LRYACLAMPEIENG-TQFKAILKRYLAAR--------LQETRLSG 281
            |  :||              :...|..:|   || .:.:..|:.::|..        ..|.....
 Worm   303 FLQRHFGGLLVDKRDDDLSRMFKLCDRVP---NGLDELRKSLENHIAKEGHQALERVAMEAATDA 364

  Fly   282 KDYIQAFLGL---CRGPLQRALRDHTKLAEVVDAVCKEEINR---------KGQIIDPTRLLVTY 334
            |.|::..|.:   .:..:.|:.::.....:.:|......||.         :.|:.....||..|
 Worm   365 KLYVKTLLEVHERYQSLVNRSFKNEPGFMQSLDKAATSFINNNAVTKRAPPQAQLTKSAELLARY 429

  Fly   335 ANELMTKRQE-SEEAIIDELK-RIVKCVEFLSDEYKFIDMYLKALRIRQINETSTSDGVESIMYS 397
            .::|:.|..: .:||.::||: :|:...:::.|:..|...|.|....|.|:|.|.||..|     
 Worm   430 CDQLLRKSSKMPDEAELEELQTKIMVVFKYIDDKDVFSKFYTKMFSKRLISELSASDEAE----- 489

  Fly   398 LLNKKMANFVTR----CIY-------VQLRDVDKLRTLKKEFQ----DHLNSKGIKLGFDFRPKC 447
                  |||:|:    |.|       ..:.|....:.|..:|:    |.|..|.::...     .
 Worm   490 ------ANFITKLKSMCGYEYTARLSKMVNDTQVSKDLTADFKEKKADMLGQKSVEFNV-----L 543

  Fly   448 FKNDGSFENF---NLTLPDELQQAWKEFRIFYEARKLQSKAIIQLNNELSSGEITCHLNQSVYIL 509
            ..:.||:..|   .:|||.:|.:..:.|..||. .|...:.:..:.:: |.||||.......|:.
 Worm   544 VLSSGSWPTFPTTPITLPQQLSKTIEIFGQFYN-EKFNGRRLTWVYSQ-SRGEITSTAFPKKYVF 606

  Fly   510 EVSTLQMAVLMLFNRHERFTEQELVTALGVELETLQEAL-KQIKFLVY---------IEVNKVNY 564
            ..:|.||..::|||..:.:|.:::..|..::.::....: ..||.||.         .||.....
 Worm   607 TATTAQMCTMLLFNEQDSYTVEQIAAATKMDEKSAPAIVGSLIKNLVLKADTELQKEDEVPMTAT 671

  Fly   565 IEINMDFTNRKRRLFCNEPLPRKMRKIEEKSEIELKIRRDKQ--VDAAIVRIMKGQKQLEYSELI 627
            :.:|..:.|:|.|:..:: ...|...:.:...::..:..|::  :.|.||||||.:|::::.:|:
 Worm   672 VSLNKAYMNKKVRVDLSK-FTMKQDAVRDTENVQKNVEEDRKSVISACIVRIMKTRKRVQHQQLM 735

  Fly   628 SLVYEELKDRVKPQVSFIKKRLDYLVEREYLER-DNYYNIYRYL 670
            :.|..:|..|.||:|..||:.:..|:|:||:.| :...::|.||
 Worm   736 TEVITQLSGRFKPKVEMIKRCIGSLIEKEYMLRTEGQKDLYEYL 779

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cul6NP_648620.1 COG5647 25..670 CDD:227934 152/693 (22%)
CULLIN 362..500 CDD:214545 39/156 (25%)
Cullin_Nedd8 606..661 CDD:287520 22/58 (38%)
cul-1NP_499309.1 Cullin 18..677 CDD:279260 123/590 (21%)
CULLIN 459..599 CDD:214545 39/158 (25%)
Cullin_Nedd8 707..774 CDD:214883 23/67 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S1033
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1040292at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11932
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.920

Return to query results.
Submit another query.