DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cul6 and cul-4

Sequence 1:NP_648620.1 Gene:Cul6 FlyBaseID:FBgn0036332 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_495525.2 Gene:cul-4 WormBaseID:WBGene00000839 Length:840 Species:Caenorhabditis elegans

Alignment Length:787 Identity:165/788 (21%)
Similarity:309/788 (39%) Gaps:212/788 (27%)


  Fly    17 LIDNILQVVNQIFDD---YTSFDGQKLMHLYHLIYKQCAAERNWNNPAQKNGRSLYIVLSDCLMK 78
            |.||:.    .|.:|   .|:.:|     |:..:...|  ::|.:.           ||.|.|:.
 Worm   125 LSDNVF----AILEDRKTVTTLEG-----LFSKVRSVC--DKNQSK-----------VLYDRLVA 167

  Fly    79 RLKNIAWVMENQLDDNKPIRL----IAKYLEH----WVPYQRSCEKLNLACYHFNRN-WVERERL 134
            .:...|..::..|:..:.:.|    ..:|||.    |..|.   .|:||.     || ::..:|:
 Worm   168 IVVQFAKSLKESLNAVEQVPLAEDNCEQYLEKFGQIWQAYP---VKINLI-----RNIFLHLDRI 224

  Fly   135 ---KGDKETYPIYRLAMISWKELVFEPSVTILAAIRLILSQMPREYNKS-LEYQVYQVLQSIVEL 195
               ..|.|..|::...|..:::..| |::.             :|:..: |...:|..:|.|::.
 Worm   225 ALGATDTEILPLWECFMQIFQKTFF-PNIF-------------KEFKATKLFNALYMAMQKIMQR 275

  Fly   196 YANDKYQDVSLPSRIDKIFTEKVMDFYKSTTLHEFQKIVVS-------------------NDYKD 241
            |..|.    .|.|.:|.:.|..|.:        ||.|.::|                   |||.:
 Worm   276 YPVDS----PLRSLVDMLQTVHVSE--------EFAKFLISQLREHYNNERIDKVPKMNCNDYME 328

  Fly   242 F--KHFLRYA----------------------CL---AMPEI----------------------- 256
            :  ....||:                      ||   |:|||                       
 Worm   329 YCEDQINRYSQLVKVNFDEPSALKDVQATVTNCLIQQAIPEILTHDFDDLIDSDNISDIGRMFNL 393

  Fly   257 ---------ENGTQFKAILKRYLAARLQETRLSGKDYIQAFLG-------LCRGPLQRALRDHTK 305
                     |..|||...||: ...:|..| ...:|.:...|.       :..|..:.| .|..|
 Worm   394 CRQCVGGEDEVRTQFSKYLKK-RGEKLIAT-CPDEDLVSELLAFKKKVDFIMTGSFKSA-NDPVK 455

  Fly   306 LAEVVDAVCKEEINRKGQIIDPTRLLVTYANELM--TKRQESEEAIIDEL-KRIVKCVEFLSDEY 367
            :.:.:....:..:|:  |:.....|:..:.:.|:  :.:..|::..:|:: ...:....:|..:.
 Worm   456 MRQCLSDAFESFVNK--QVDRSAELISKHFHTLLHSSNKNVSDDTTLDQMVDEAIVLFRYLRGKD 518

  Fly   368 KFIDMYLKALRIRQINETSTSDGVESIMYSLLNKKMANFVTRCIYVQLRDVDKLRT---LKKEFQ 429
            .|...|.:.|..|...|.|.|...|.::...|..:..:..|..:....:|:|....   |..::.
 Worm   519 VFEAYYKRGLAKRLFLERSASVDAEKMVLCKLKTECGSAFTYKLEGMFKDMDASENYGRLFNQYL 583

  Fly   430 DHLNSKGIKLGFDFR---PKCFKNDGSFENFNLTLPDELQQAWKEFRIFYEARKLQSKAIIQLNN 491
            :|:|.:  |..|..|   |:.:.   :::.:.:.:|.|::....:::.||  |.......::.::
 Worm   584 EHMNKE--KANFTARVITPEYWP---TYDTYEINIPKEMRDTLTDYQDFY--RVQHGNRNVKWHH 641

  Fly   492 ELSSGEITCHLNQSVYILEVSTL-QMAVLMLFNRHERFTEQELVTALGV-ELETLQEALKQI--- 551
            .|:|..|:...........::|: |..:|:|||:.|.:|..|:|....: |:|.::..|..:   
 Worm   642 GLASAVISASFRPGCKKELIATMYQTVILLLFNKCETWTVAEIVEHTKILEIEVVKNVLALLGGR 706

  Fly   552 ---KFLVYIE----VNKVNYIE--------INMDFTNRKRRLFCNEPLPRKMRK--IEEKSEIEL 599
               |.|..:|    ..|...:|        :|..||.::    |...:.:...|  :||..|::.
 Worm   707 DKPKVLQRVEGGGSEKKEGTVENLKNEKFVVNSKFTEKR----CRVRIAQVNIKTAVEETKEVKE 767

  Fly   600 KIRRDKQ--VDAAIVRIMKGQKQLEYSELISLVYEELKDRVKPQVSFIKKRLDYLVEREYLERD- 661
            ::..|:|  :|||:|||||.:|||.:..|::.:.::|  |.....:.|||||:.|:||||:.|| 
 Worm   768 EVNSDRQYKIDAAVVRIMKARKQLNHQTLMTELLQQL--RFPVSTADIKKRLESLIEREYISRDP 830

  Fly   662 ---NYYN 665
               :.||
 Worm   831 EEASSYN 837

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cul6NP_648620.1 COG5647 25..670 CDD:227934 162/780 (21%)
CULLIN 362..500 CDD:214545 28/144 (19%)
Cullin_Nedd8 606..661 CDD:287520 26/57 (46%)
cul-4NP_495525.2 Cullin 123..740 CDD:279260 128/683 (19%)
PKc_like <253..336 CDD:304357 19/108 (18%)
CULLIN 513..652 CDD:214545 28/146 (19%)
Cullin_Nedd8 774..831 CDD:287520 27/59 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1040292at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11932
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.