DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cul6 and LOC108180715

Sequence 1:NP_648620.1 Gene:Cul6 FlyBaseID:FBgn0036332 Length:670 Species:Drosophila melanogaster
Sequence 2:XP_021324604.1 Gene:LOC108180715 ID: Length:80 Species:Danio rerio

Alignment Length:49 Identity:19/50 (38%)
Similarity:26/50 (52%) Gaps:4/50 (8%)


  Fly   493 LSSGEITCHLNQSVYILEVSTLQMAVLMLFNRHER----FTEQELVTAL 537
            :|:|.||.......|.|||:|.|:|||..:|:..|    |...:|.|.|
Zfish     1 MSNGIITFKNEVGQYDLEVTTFQLAVLFAWNQRPREKISFENLKLATEL 49

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cul6NP_648620.1 COG5647 25..670 CDD:227934 19/50 (38%)
CULLIN 362..500 CDD:214545 4/7 (57%)
Cullin_Nedd8 606..661 CDD:287520
LOC108180715XP_021324604.1 Cullin <1..59 CDD:331336 19/50 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1040292at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.