powered by:
Protein Alignment Cul6 and LOC108180715
DIOPT Version :9
| Sequence 1: | NP_648620.1 |
Gene: | Cul6 / 39474 |
FlyBaseID: | FBgn0036332 |
Length: | 670 |
Species: | Drosophila melanogaster |
| Sequence 2: | XP_021324604.1 |
Gene: | LOC108180715 / 108180715 |
-ID: | - |
Length: | 80 |
Species: | Danio rerio |
| Alignment Length: | 49 |
Identity: | 19/49 - (38%) |
| Similarity: | 26/49 - (53%) |
Gaps: | 4/49 - (8%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 493 LSSGEITCHLNQSVYILEVSTLQMAVLMLFNRHER----FTEQELVTAL 537
:|:|.||.......|.|||:|.|:|||..:|:..| |...:|.|.|
Zfish 1 MSNGIITFKNEVGQYDLEVTTFQLAVLFAWNQRPREKISFENLKLATEL 49
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
0 | 0.000 |
Not matched by this tool. |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
1 |
1.010 |
- |
- |
|
D1040292at2759 |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
0 | 0.000 |
Not matched by this tool. |
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
| ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.