DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cul6 and cul2

Sequence 1:NP_648620.1 Gene:Cul6 FlyBaseID:FBgn0036332 Length:670 Species:Drosophila melanogaster
Sequence 2:XP_002935209.2 Gene:cul2 XenbaseID:XB-GENE-960931 Length:766 Species:Xenopus tropicalis

Alignment Length:825 Identity:163/826 (20%)
Similarity:309/826 (37%) Gaps:225/826 (27%)


  Fly     1 MNRVKRISNYFDSMLPLIDNILQVV----------NQIFDDYTSFDGQKLMHLYHLIYKQCAAER 55
            |:...|:.::.::...|:..|..||          |..|.|               ||..|.|  
 Frog     1 MSLKPRVVDFDETWNKLLTTIKAVVMLDYVERATWNDRFSD---------------IYALCVA-- 48

  Fly    56 NWNNPAQKNGRSLYIVLSDCLMKRLKNIAWVMENQLDDNKPIRLIAKYLEHWVPYQRSCEKLNLA 120
             :..|.   |..||......|...::.:   ....||..:  :::..|..:|..|.|..:.::..
 Frog    49 -YPEPL---GERLYTETKIFLENHVQQL---HTRVLDSAE--QVLVMYYRYWEEYSRGADYMDCL 104

  Fly   121 CYHFNRNWVERERLKGDKETY------------PIYRLAMISWKELVFEPSVTILAAIRLILSQM 173
            ..:.|..::::.:|......|            .|..||:..|::|:.||....|  :|::|.::
 Frog   105 YRYLNTQYIKKNKLTEADLQYGYGGVDMNEPLMEIGELALDLWRKLMIEPLQDTL--LRMLLKEI 167

  Fly   174 PR-----------------------EYNKSLEYQVYQVLQSIVELYANDKY--QDVS--LPSRID 211
            .|                       :|.|....:.||.:..:..|....:|  |:.|  |.....
 Frog   168 KRDRCGEDPNQKVIHGVINSFVHVEQYKKKFPLKFYQEIFELPFLAETGEYYKQEASNLLQESNC 232

  Fly   212 KIFTEKVMDFYK---------------STTLHEFQKIVVSNDYKDFKH----------------- 244
            ..:.||::...|               :..:||.|:.:|: |:..|.|                 
 Frog   233 SQYMEKILGRLKDEEIRCRKYLHPSSYNKVIHECQQRMVA-DHLQFLHAECHNIIRQERRSDMAN 296

  Fly   245 ---FLRYACLAMP----EIENGTQ---FKAILKRYLAARLQETRLSGKDYIQAFLGLCRGPLQRA 299
               .||.....:|    |::|...   .:||           :.||.::....|       ::..
 Frog   297 MYTLLRAVSNGLPHMIQELQNHIHDEGLRAI-----------SNLSQENMPTQF-------VESV 343

  Fly   300 LRDHTKLAEVVDAV----------------CKEEINRKGQIIDPTRLLVTYANELMTKRQE--SE 346
            |..|:|..::|::|                |.........:.....||..|.:.::.|..:  :|
 Frog   344 LEVHSKFVQLVNSVLNGDQHFMSALDKALTCVVNYREPKSVCKAPELLAKYCDNMLKKSAKGMTE 408

  Fly   347 EAIIDELKRIVKCVEFLSDEYKFIDMYLKALRIRQINETSTSDGVESIMYSLLNKKMANFVTRCI 411
            ..:.|:|...:...:::.|:..|...|.:.|..|.|:..|.|...|..|.:.|.:......|..:
 Frog   409 NEVEDKLTSFITVFKYIDDKDVFQKFYARMLAKRLIHGLSMSMDSEETMINKLKQACGYEFTSKL 473

  Fly   412 YVQLRDVDKLRTLKKEFQDHLNSKG--IKLGFDFR---------PKCFKNDGSFENFNLTLPDEL 465
            :....|:.....|..:|.:.:.::.  |.||..|:         |.......:|     .:|.||
 Frog   474 HRMYTDMSVSADLNNKFNNFIKNQDTVIDLGISFQIYVLQAGAWPLTQAPSSTF-----AIPQEL 533

  Fly   466 QQAWKEFRIFY----EARKLQSKAIIQLNNELSSGEITCHLNQSVYILEVSTLQMAVLMLFNRHE 526
            :::.:.|.:||    ..|||      ...:.|.:||:..:.....|:..|:|.|||||:.||..|
 Frog   534 EKSVQMFELFYNQHFSGRKL------TWLHYLCTGEVKMNYLCKPYVAMVTTYQMAVLLAFNNSE 592

  Fly   527 RFTEQELVTALGVELETLQEALKQIKFLVYIEVNKVNY------------IEINMDFTNRKRRLF 579
            ..|.:||..:..:..:.|.:.:|.:     ::|..:|:            ..:||:|::::.:..
 Frog   593 IVTYKELQDSTQMNEKELTKTIKSL-----LDVKMINHDSDKEDIDGESTFSLNMNFSSKRTKFK 652

  Fly   580 CNEPLPR--------------KMRKIEEKSEIELK-----IRRDKQ--VDAAIVRIMKGQKQLEY 623
            ...|:.:              .:.:.|.:..:|::     :..|::  :.||||||||.:|.|.:
 Frog   653 ITTPMQKDTPQGAQPTCAEEAMLWRGERRFSLEVEQTRSAVDEDRKMYLQAAIVRIMKARKILRH 717

  Fly   624 SELISLVYEELKDRVKPQVSFIKKRLDYLVEREYLER-----DNY 663
            :.||..|..:.:.|..|.:|.|||.::.|::::|:||     |.|
 Frog   718 NALIQEVISQSRARFNPSISMIKKCIEVLIDKQYIERSQASADEY 762

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cul6NP_648620.1 COG5647 25..670 CDD:227934 158/802 (20%)
CULLIN 362..500 CDD:214545 33/153 (22%)
Cullin_Nedd8 606..661 CDD:287520 23/62 (37%)
cul2XP_002935209.2 Cullin 30..643 CDD:279260 127/676 (19%)
CULLIN 424..568 CDD:214545 33/155 (21%)
Cullin_Nedd8 693..760 CDD:214883 24/67 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1040292at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.