DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cul6 and cul4b

Sequence 1:NP_648620.1 Gene:Cul6 FlyBaseID:FBgn0036332 Length:670 Species:Drosophila melanogaster
Sequence 2:XP_017951653.1 Gene:cul4b XenbaseID:XB-GENE-963628 Length:865 Species:Xenopus tropicalis

Alignment Length:744 Identity:162/745 (22%)
Similarity:301/745 (40%) Gaps:151/745 (20%)


  Fly    30 DDYTSFDGQKLMHLYHLIYKQCAAERNWNNPAQKNGRSLYIVLSDCLMKRLKNI------AWVME 88
            ::||....|||......|....:.:.|.....|.........:|..|.|:|:.|      |.:.:
 Frog   162 ENYTDETWQKLKGAVEAIQNSTSIKYNLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQ 226

  Fly    89 NQLDDNKPIRLIAKYLEHWVPYQRSCEKLNLACYHFNRNWVERERLKGDKETYPIYRLAMISWKE 153
            .:.|....:..:.|..:.|..:.|....:.......:|.:|.:..:...     |:.:.:..::.
 Frog   227 FREDALDSVLFLKKIDKCWQDHCRQMIMIRSIFLFLDRTYVLQNSMLPS-----IWDMGLELFRN 286

  Fly   154 LVFEPSVTILAAIRLILSQMPREYN-----KSLEYQVYQVLQSIVELYAN-DKYQDVSLPSRIDK 212
            .:..........|..||..:.||.|     :||       |:|::.:.:: ..|||     ..::
 Frog   287 HIISDQKVQNKTIDGILLLIERERNGEAIDRSL-------LRSLLSMLSDLQIYQD-----SFEQ 339

  Fly   213 IFTEKVMDFYKSTTLHEFQKIVVSNDYKDFKHFL-----RYACLAMPEIENGTQ-------FKAI 265
            .|.|:....|.:    |.|:::...:..::.|.:     ..|...:..::..||       .|.:
 Frog   340 RFLEETNRLYAA----EGQRLMQEREVPEYLHHVNKRLEEEADRVITYLDQSTQKPLIATVEKQL 400

  Fly   266 LKRYLAARLQ--------ETRLSGKDYIQAFLGLCRGPLQRAL-------------------RDH 303
            |..:|.|.||        |.|:.....:.......||.:|..|                   :|.
 Frog   401 LGEHLTATLQKGLNHLLDENRIQDLSLLYQLFSRVRGGVQVLLQHWIEYIKAFGSTIVINPEKDK 465

  Fly   304 TKLAEVVD---------AVC--KEE-------------INRKGQIIDPTRLLVTYANELMTKRQE 344
            |.:.|::|         .||  |.|             ||::..  .|..|:..|.:..:  |..
 Frog   466 TMVQELLDFKDKVDHVIDVCFLKNEKFVNAMKEAFETFINKRPN--KPAELIAKYVDSKL--RTG 526

  Fly   345 SEEAIIDELKRIVKCV----EFLSDEYKFIDMYLKALRIRQINETSTSDGVESIMYSLLNKKMAN 405
            ::||..:||::::..:    .|:..:..|...|.|.|..|.:...|.|...|..|.|.|..:...
 Frog   527 NKEATDEELEKMLDKIMIIFRFIYGKDVFEAFYKKDLAKRLLVGKSASVDAEKSMLSKLKHECGA 591

  Fly   406 FVTRCIYVQLRDVDKLRTLKKEFQDHLNSKGIK---------LGFDFRPKCFKNDGSFENFNLTL 461
            ..|..:....:|::..:.:...|:.::.::.:.         |...:.|       ::....:.|
 Frog   592 AFTSKLEGMFKDMELSKDIMVHFKQYMQNQNVPGNIELTVNILTMGYWP-------TYVPMEVHL 649

  Fly   462 PDELQQAWKEFRIFY----EARKLQSKAIIQLNNELSSGEITCHLNQSVYILEVSTLQMAVLMLF 522
            |.|:.:..:.|:.||    ..|||      |..:.|....:....|:....|:||..|..||::|
 Frog   650 PPEMVKLQEIFKTFYLGKHSGRKL------QWQSTLGQCVLKAEFNEGKKELQVSLFQTLVLLMF 708

  Fly   523 NRHERFTEQELVTALGVELETLQEALKQI-----KFLVYI----EVNKVNYIEINMDFTNRKRRL 578
            |..:.|:.:|:..|.|:|...|:..|:.:     :.||..    :|:..:....|.||.::..|:
 Frog   709 NEGDEFSLEEIRQATGIEDSELRRTLQSLACGRARVLVKSPKSKDVDDGDKFTFNDDFRHQLFRI 773

  Fly   579 FCNEPLPRKMRK-IEEKSEIELKIRRDK--QVDAAIVRIMKGQKQLEYSELISLVYEELKDRVKP 640
            ..|:   .:|:: :||::....::.:|:  |:|||||||||.:|.|.::.|:|.||.:||..|||
 Frog   774 RINQ---IQMKETVEEQASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKP 835

  Fly   641 QVSFIKKRLDYLVEREYLERD----NYYN 665
              :.:|||::.|::|:|:|||    |.||
 Frog   836 --ADLKKRIESLIDRDYMERDKENPNQYN 862

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cul6NP_648620.1 COG5647 25..670 CDD:227934 162/745 (22%)
CULLIN 362..500 CDD:214545 28/151 (19%)
Cullin_Nedd8 606..661 CDD:287520 29/55 (53%)
cul4bXP_017951653.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1040292at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.