DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cul6 and cul5b

Sequence 1:NP_648620.1 Gene:Cul6 FlyBaseID:FBgn0036332 Length:670 Species:Drosophila melanogaster
Sequence 2:XP_009293667.1 Gene:cul5b ZFINID:ZDB-GENE-091113-45 Length:807 Species:Danio rerio

Alignment Length:853 Identity:181/854 (21%)
Similarity:324/854 (38%) Gaps:258/854 (30%)


  Fly    11 FDSMLPLIDNILQVVNQIFDDYTSFDGQKLMHLYHLIYKQCAAERNWNNPAQKNGRSLYIVLSDC 75
            :|.|.|:   :|:::.|     .|...|:...|:..::..|.    |::   |....::..|.:.
Zfish    19 WDLMRPI---VLKLLRQ-----ESVTKQQWFDLFSDVHAVCL----WDD---KGPAKIHQALKED 68

  Fly    76 LMKRLKNIAWVMENQL-------------DDNKPIRLIAKYLEHWVPYQRSCE-------KLNLA 120
            ::..:|. |..|||.:             ||.   .|:..|:..|..:...|:       ||.:.
Zfish    69 ILDFIKQ-AQAMENIIVFLSLCVRVLSHQDDT---ALLKAYIVEWRKFFTQCDILPKPFSKLEIT 129

  Fly   121 CYHFNRNWVERERLKGDKETYPIYRLAMISWKELVFEPSVTIL--AAIRLI-LSQMPREYNKSLE 182
            ... |:.    ...|.:.|...:.:|.:.:|.|.:|....:.|  :|::|: ..::...::..| 
Zfish   130 LLG-NQG----SNKKSNVEDSIVRKLMLDTWNESIFCNIKSRLQDSAMKLVHAERLGEAFDSQL- 188

  Fly   183 YQVYQVLQSIVELYAN--DKYQDVSLPSRIDKIFTEKVMDFYKSTTLHEFQKIVVSNDYK----- 240
              |..|.:|.|.|.:|  ||.|  ......:|.:.:....|||:......|:..|.|..|     
Zfish   189 --VIGVRESYVNLCSNTDDKLQ--IYRENFEKSYLDSTERFYKTQAPSYLQQNGVQNYMKYADGK 249

  Fly   241 ---DFKHFLRY-------------------------------ACLAM-----PEIE----NGTQF 262
               :.|..|||                               .|..|     .|.|    :||:.
Zfish   250 LREEEKRALRYLETRRECNSVQALMECCVNALVTSFKETILTECPGMIKRNETESEYGRSSGTKG 314

  Fly   263 KAILKRYLAARLQETRLSGKDYIQAFLGLCRGPLQRALRDHTKLAEVVDAVCKEE---------- 317
            .|..:.:|...|.:...||.:           |:.:.|.||...|.:.|.|...|          
Zfish   315 SASSELHLMFSLMDKVPSGIE-----------PMLKDLEDHIMSAGLADMVASAETITTDSEKYV 368

  Fly   318 ------INRKGQII------DPTRLLVTYANELMTKRQESEEAIIDE---------LKR------ 355
                  .||..:::      ||         ..:|.|.::.:|::::         ||:      
Zfish   369 EQLLTLFNRFSKLVKEAFQDDP---------RFLTSRDKAYKAVVNDATIFKLELPLKQKGVSLK 424

  Fly   356 ---IVKCVEFLSDEYKFIDMYLKALRIRQINETSTSDGVESIMYSLL-------NKKM------A 404
               ..||.|.|::   :.||   .||...:::..||:.:|:.:..:|       ||.:      |
Zfish   425 TQPESKCPELLAN---YCDM---LLRKTPLSKKLTSEEIEAKLKEVLLVLKYVQNKDVFMRYHKA 483

  Fly   405 NFVTRCI------------YVQ-LRDV----DKLRTLKKEFQDHLNSKGIKLGFDFRPKCFK--- 449
            :...|.|            .|: ||:|    |.:..|.:.|||...|:.:...|....|..|   
Zfish   484 HLTRRLILDISADSEIEENMVEWLREVGMPADYVNKLARMFQDIKVSEDLNQSFKEMHKHNKLAL 548

  Fly   450 ----------NDG----SFENFNLTLPDELQQAWKEFRIFYEARKLQSKAIIQLNNELSSGEITC 500
                      |.|    |.|...::||.||:....|...||  :|..|...:..::.:|:|.||.
Zfish   549 PADSVNIKILNAGAWSRSSEKVFVSLPTELEDLIPEVEDFY--KKNHSGRKLHWHHLMSNGIITF 611

  Fly   501 HLNQSVYILEVSTLQMAVLMLFNR--HERFTEQELVTALGVELETLQEALKQIKFLVYIEVNKVN 563
            ......|.|||:|.|:|||..:|:  .||.:.:.|..|..:....|:..|..:.....::...::
Zfish   612 KNEVGQYDLEVTTFQLAVLFAWNQRPRERISFENLKLATELPDAELRRTLWSLVAFPKLKRQVLS 676

  Fly   564 Y---------------IEINMDFTNRKRRLFCNEPLPR---------------KMRKIEEKSEIE 598
            |               ..||.:|:     |..|..:.:               :||:.|.:..::
Zfish   677 YEPVVGSPKDFAEGTVFSINQEFS-----LIKNSKVQKRGKINLIGRLQLTTERMREEENEGIVQ 736

  Fly   599 LKIRRDKQVDAAIVRIMKGQKQLEYSELISLVYEELKDRVKPQVSFIKKRLDYLVEREYLERDNY 663
            |:|.|.::   ||::|||.:|::..::|.:.:.|.||:...||...||:::::|:|.:|::||..
Zfish   737 LRILRTQE---AIIQIMKMRKRISNAQLQTELVEILKNMFLPQKKMIKEQIEWLIEHKYIKRDET 798

  Fly   664 -YNIYRYL 670
             .|.:.|:
Zfish   799 DINTFIYM 806

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cul6NP_648620.1 COG5647 25..670 CDD:227934 177/838 (21%)
CULLIN 362..500 CDD:214545 44/185 (24%)
Cullin_Nedd8 606..661 CDD:287520 18/55 (33%)
cul5bXP_009293667.1 Cullin 20..698 CDD:279260 151/735 (21%)
CULLIN 470..613 CDD:214545 35/145 (24%)
Cullin_Nedd8 740..799 CDD:287520 20/62 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1040292at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.