DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12520 and DIA2

DIOPT Version :8

Sequence 1:NP_001097596.1 Gene:CG12520 / 39466 FlyBaseID:FBgn0036324 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_014723.2 Gene:DIA2 / 854247 SGDID:S000005606 Length:732 Species:Saccharomyces cerevisiae

Alignment Length:395 Identity:80/396 (20%)
Similarity:125/396 (32%) Gaps:140/396 (35%)


  Fly     3 LANIEELYNDCLYHIFDFLTTEDRIIFAQVCHRFRQLFINHCAAKYRVYTLDKDS---------- 57
            |..||.::.:.|..|||...:..|.....|..|...:         ::.|.|.|.          
Yeast   367 LKKIELIFVNSLVPIFDGNNSVGRDGSFNVMARHTNM---------QISTADNDEQGIVEEKVIY 422

  Fly    58 SRLELI----------QFCICRE------------TVECLTIDLDHFDTARC--------YRTYG 92
            |.||.|          .|.:||.            |:..:|..:::.|....        .:...
Yeast   423 SELEKITLICDKKKIKNFPLCRALLRGQFPLLQKLTITGVTFPMNNQDIMNFQWLLNFPDLKELW 487

  Fly    93 CETPENC----FQILCQTLAGMLRLEHLVVKQESMLVTPIQKPFDQILTAVRHLPKLRRLEIRAR 153
            .|..:||    |..|.:.......||.|..: |:.|...:....||.:|....:|.:...:    
Yeast   488 IEDNDNCELSKFLQLLKFSNVWKNLEKLTFR-ENKLYPIVNLDEDQPVTNDDEVPSMLFYK---- 547

  Fly   154 DDSSFDRVSQLCHLEELQMLVPKISLAALVKCCR----SSGNLRSLHLGYACIQKNLSHIVPHCK 214
                    ..|.:||:|.::...||.:||.:.|.    ....||||::|             :|.
Yeast   548 --------ENLQNLEKLDLMGTSISGSALTRLCEQEYLDGRKLRSLNIG-------------NCP 591

  Fly   215 NLKVLKFGMPANSSEYVQ--------LARLPKLGE--LSYFGIRRSGSFE------PLLSAL--- 260
            |::     .|.|.:...:        |.||.||.|  ||:.......:.:      |.|..|   
Yeast   592 NIQ-----FPNNHAHTARMILDVNAVLKRLSKLEEINLSHLSSLNDSTMKSFIINVPFLENLKRL 651

  Fly   261 ---------------------------AAKSQLTHLSIDGGSLTMQETCQLVRIQSLRHFKGFYS 298
                                       |....|.:|:|||.|.....|..::|.|:|      .:
Yeast   652 DISHNFEITGISIYEFLKKFQMDHDNEAGGQPLAYLNIDGCSQVSHITVNMIRAQNL------VT 710

  Fly   299 TTDCV 303
            ..|||
Yeast   711 QVDCV 715

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12520NP_001097596.1 FBOX 11..44 CDD:197608 7/33 (21%)
DIA2NP_014723.2 TPR_11 16..109 CDD:290150
TPR repeat 19..43 CDD:276809
TPR repeat 69..107 CDD:276809
TPR repeat 112..140 CDD:276809
F-box 209..>241 CDD:279040
leucine-rich repeat 483..511 CDD:275380 5/28 (18%)
leucine-rich repeat 553..581 CDD:275381 8/28 (29%)
leucine-rich repeat 582..618 CDD:275381 12/54 (22%)
leucine-rich repeat 619..647 CDD:275381 6/28 (21%)
leucine-rich repeat 648..673 CDD:275381 1/25 (4%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR16134
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.