DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12520 and AT4G05497

DIOPT Version :8

Sequence 1:NP_001097596.1 Gene:CG12520 / 39466 FlyBaseID:FBgn0036324 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_849530.1 Gene:AT4G05497 / 830176 AraportID:AT4G05497 Length:246 Species:Arabidopsis thaliana

Alignment Length:265 Identity:66/266 (25%)
Similarity:101/266 (38%) Gaps:65/266 (24%)


  Fly    88 YRTYGCETPENCFQILCQTLAGMLRLEHLVVKQESMLVTPIQKPFDQILTAVRHLPKL-RRLEIR 151
            ||.:....||....||       |||..:.:.|.:..|.   |.:.::...    |.: |:::||
plant    18 YRNWAELPPELTSSIL-------LRLGAIEILQNAQRVC---KSWRRVCQD----PSMWRKIDIR 68

  Fly   152 ARDDSSFDRVSQLCHLEELQMLVPKISLAALVK--CCR----SSGNLRSLHLGYACIQKNLSHIV 210
            .:::                 ||..:.|..:::  |||    |.|.|..:::.|......|::|.
plant    69 IKEN-----------------LVNSVELFYVIEPLCCRAVDLSQGGLLEINIDYLVNTSFLNYIA 116

  Fly   211 PHCKNLKVLKFGM----PANSSEYVQLA-RLPKLGELSY---FGIRRS-----GSFEPLLSALAA 262
            ....||:  :.|:    |..|...|:.| :||.|.||..   ..||..     |...|.|..|..
plant   117 DRSSNLR--RLGVVDCAPVLSRGVVEAAMKLPLLEELDITYKSSIREQELKVVGQSCPNLRTLKL 179

  Fly   263 KSQLTHLSIDGGSLTMQETCQLVRIQSLRH---FKGFYSTTDCVEML-GC--LANLE-ELCVSIF 320
            .........|..:|.:.||     :..|||   |:...|.|....:| ||  |.||. ..|::|.
plant   180 NCTGDVKCCDKVALAIAET-----MPGLRHLQLFRNGLSETGLNAILEGCPHLKNLGLHQCLNIN 239

  Fly   321 CPTDI 325
            ...||
plant   240 IVGDI 244

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12520NP_001097596.1 FBOX 11..44 CDD:197608
AT4G05497NP_849530.1 F-box-like 21..68 CDD:289689 13/61 (21%)
leucine-rich repeat 98..121 CDD:275381 4/23 (17%)
AMN1 <106..246 CDD:187754 40/147 (27%)
leucine-rich repeat 122..147 CDD:275381 8/27 (30%)
leucine-rich repeat 148..173 CDD:275381 7/25 (28%)
leucine-rich repeat 174..201 CDD:275381 6/32 (19%)
leucine-rich repeat 202..226 CDD:275381 9/24 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR16134
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.