DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12520 and Fbxl3

DIOPT Version :8

Sequence 1:NP_001097596.1 Gene:CG12520 / 39466 FlyBaseID:FBgn0036324 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001347270.1 Gene:Fbxl3 / 50789 MGIID:1354702 Length:428 Species:Mus musculus

Alignment Length:415 Identity:82/416 (20%)
Similarity:142/416 (34%) Gaps:122/416 (29%)


  Fly     9 LYNDCLYHIFDFLTTEDRIIFAQVCHRFRQLF------------INHCAAKYRVYT--------L 53
            |..|.:.|:|.:|...||...:|||..:.|:|            :|..|..|...|        :
Mouse    39 LLQDIVLHVFKYLPLLDRAHASQVCRNWNQVFHMPDLWRCFEFELNQPATSYLKATHPELIKQII 103

  Fly    54 DKDSSRLELIQFCICRETVECLTIDLDHFDTARCYRTYGCETPENCFQILCQTLAGMLRLEHLVV 118
            .:.|:.|:.:.|.:               |:::       |:.|....||.|.:...|:...|:.
Mouse   104 KRHSNHLQYVSFKV---------------DSSK-------ESAEAACDILSQLVNCSLKTLGLIS 146

  Fly   119 KQESMLVTPIQKPFDQILTAV-RHLPKLRRLEIRARDDSSFD----RVSQLCHLEELQML----V 174
            ......:...:..|...||.| .:...|..|:|   ||:..|    :|....:.:.|::|    .
Mouse   147 TARPSFMDLPKSHFISALTVVFVNSKSLSSLKI---DDTPVDDPSLKVLVANNSDTLKLLKMSSC 208

  Fly   175 PKISLAALVKCCRSSGNLRSLHLGYACIQKNL-------SHI-VPHCK------NLKVLKFGMPA 225
            |.:|.|.::........||.|.|.|..:...|       .|: :.|.:      |.....|....
Mouse   209 PHVSPAGILCVADQCHGLRELALNYHLLSDELLLALSSEKHVRLEHLRIDVVSENPGQTHFHTIQ 273

  Fly   226 NSSEYVQLARLPKLGELSYFGIRRSGSFEPLLSALAAKSQLTHLSIDGGSLT------MQETCQL 284
            .||....:...||:..:.||.:... .|:|.   ...:...|||.. |.|::      :..||..
Mouse   274 KSSWDAFIKHSPKVNLVMYFFLYEE-EFDPF---FRYEIPATHLYF-GRSVSKDVLGRVGMTCPR 333

  Fly   285 VRIQSLRHFKGFYSTTDCVEMLGCLANLEELCVSIFCPTDISNNLLPIIAKCKNL---------- 339
            :                 ||::.|...|..|          ...|:.|..:||||          
Mouse   334 L-----------------VELVVCANGLRPL----------DEELIRIAERCKNLSAIGLGECEV 371

  Fly   340 ------KLLQISGGNVNTKSLNDAI 358
                  :.:::.||.::..|:.:.:
Mouse   372 SCSAFVEFVKMCGGRLSQLSIMEEV 396

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12520NP_001097596.1 FBOX 11..44 CDD:197608 12/45 (27%)
Fbxl3NP_001347270.1 F-box-like 36..77 CDD:315592 12/38 (32%)
LRR 1 119..146 7/34 (21%)
leucine-rich repeat 174..199 CDD:275381 7/28 (25%)
LRR 2 181..207 5/26 (19%)
leucine-rich repeat 200..225 CDD:275381 5/25 (20%)
LRR 3 208..233 7/25 (28%)
LRR 4 234..259 3/25 (12%)
leucine-rich repeat 252..286 CDD:275381 6/34 (18%)
leucine-rich repeat 287..333 CDD:275381 11/51 (22%)
LRR 5 316..341 7/42 (17%)
leucine-rich repeat 334..360 CDD:275381 9/53 (17%)
LRR 6 343..368 8/35 (23%)
leucine-rich repeat 361..383 CDD:275381 1/22 (5%)
LRR 7 369..394 3/25 (12%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR16134
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.