DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12520 and CG14102

DIOPT Version :8

Sequence 1:NP_001097596.1 Gene:CG12520 / 39466 FlyBaseID:FBgn0036324 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_649147.2 Gene:CG14102 / 40156 FlyBaseID:FBgn0036906 Length:441 Species:Drosophila melanogaster

Alignment Length:391 Identity:79/392 (20%)
Similarity:144/392 (37%) Gaps:111/392 (28%)


  Fly     8 ELYNDCLYHIFDFLTT-EDRIIFAQVCHRFRQLFINHCAAKYRVYTLDKDSSRL--------ELI 63
            :|..||.:.||.::.. ||::...:....|:.:..:....:::     |.:.||        .|:
  Fly    28 DLNYDCYHQIFSYINVLEDQLNLGRAHPLFQVVLTDILRTRHK-----KINVRLLKTIPDWEFLL 87

  Fly    64 QFCICRETVECLTIDLDHFDTARCYRTYGCETPENCFQIL------CQTLAGMLRLEHLVVKQES 122
            |.|              ..:.:||...:|.......:..|      |..|.     :.:::...:
  Fly    88 QLC--------------GSEVSRCEVPHGSWDEPFTYPFLGLLGRHCPKLR-----QAVIIFMHA 133

  Fly   123 MLVTPIQKPFDQ--ILTAVRHLPKLRRLEIRARDDSSFDRVSQLCHLEELQM--LVPKISLAALV 183
            :..:| .|..|:  |:..:..||.|..|.:.....:..|::.....||.|.:  :.|.:|.|:..
  Fly   134 VTESP-PKSGDRGHIMQLLLELPSLTNLTLIDARSAQLDQLRHFSKLEALDLDGIDPNLSNASFQ 197

  Fly   184 KCCRSSGNLRSLHLGYACIQKNLSHIV-------PHCKNLKVLKFGMPANSSEYVQLARLPKLGE 241
            :...|..:|:.|.|.:. ..:..||.|       |:..:|.:..|.|           ..|:|||
  Fly   198 QMFESMASLKRLLLNFG-PDRRRSHQVPLLADKFPNLDHLTLENFDM-----------SFPELGE 250

  Fly   242 LSYFGIRRSGSFEPLLSALAA------------------KSQLTHLSIDGGSLTMQETCQLVRIQ 288
              :.|:|..    .|:|...|                  |.||..:.:.|.        |:..|.
  Fly   251 --FKGLRSL----RLISRWTAEVDNDFYRSVAKRVSNLQKLQLISVRVRGD--------QVHHIL 301

  Fly   289 SLRHFKGFYSTTDC-------VEMLGCLANLEELCVSIFC---PTDISNNLLPIIAKCKNLKLLQ 343
            ::|..    :..||       |..||.|.:||  |:::.|   |.:.|..|:.::..|.||..|:
  Fly   302 AIRQL----NALDCDNWPAQSVSQLGQLKDLE--CLALDCIDSPANPSRQLMLLVQNCYNLNHLR 360

  Fly   344 I 344
            :
  Fly   361 L 361

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12520NP_001097596.1 FBOX 11..44 CDD:197608 7/34 (21%)
CG14102NP_649147.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR16134
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.