DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12520 and CG15412

DIOPT Version :8

Sequence 1:NP_001097596.1 Gene:CG12520 / 39466 FlyBaseID:FBgn0036324 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001259996.1 Gene:CG15412 / 33553 FlyBaseID:FBgn0031528 Length:486 Species:Drosophila melanogaster

Alignment Length:406 Identity:84/407 (21%)
Similarity:162/407 (40%) Gaps:87/407 (21%)


  Fly     5 NIEELY--NDCLYHIFDFLTTEDRIIFAQVCHRFRQLFINHCAAKYRVYTLDKDSSRLELIQFCI 67
            ||:.::  .:.:::::|.:         :.|.:..:|::.:.|....:..:....:||:::.  |
  Fly   121 NIKGIWVKEEHMHYMYDIV---------RKCKQLVKLYVPYIANDRLLEEIGNCCTRLQILD--I 174

  Fly    68 CRETVECLTIDLDHFDTARCYRT-----YGCETPEN-CFQILCQTLAGMLRLEHL----VVKQES 122
            ..|| :...|.:|......|.::     .|....|| |:..:.      |.|||.    .:...|
  Fly   175 SGET-DITEIGIDLLAKGVCSQSLTVVDVGMPGEENICYSDIA------LILEHCPQVETLSTYS 232

  Fly   123 MLVTPIQKPFDQILTAVRHLPKLRRLEIRARDDSSFDRVSQLC-HLEELQMLVPKI-SLAALVKC 185
            .:...::...|.:  ..|...:|:.:.....|:::...:.|.| .||.|.:..||. ||.||   
  Fly   233 FVGASLKFIHDNV--DDRFKCRLKYIHDTGTDEATLQVIMQTCPRLETLYLDSPKTGSLRAL--- 292

  Fly   186 CRSSGNLRSLHLGYACIQKNLSHIV--PHCKNLKVLKFGMPANSSEYVQLARL-PKLGELSYFGI 247
              |:.|||.|.: |..:...|..::  |..:||:.|.......:.|..:|||| |.|.:|..:.|
  Fly   293 --STRNLRKLKI-YKFVVAELLPLLERPIGRNLRHLTMIKGLGNLELGKLARLCPSLIDLDCYMI 354

  Fly   248 ------------RRSGSFEPLLSALAAKS---------QLTHLSIDGGSLTMQETCQLVRIQSLR 291
                        ::....|.|.||:...|         .|..|::|    |::.|...:....::
  Fly   355 DSLSYGAGHAKFQQLEGLEILSSAILTSSLKAFLCNSTDLKRLAVD----TVEFTDDDIMSMFMQ 415

  Fly   292 H-FKGFYSTTDCVEMLGCLANLEELCVSIFCPTDISNNLLPIIAKCKNLKLL-QISGGNVNTKSL 354
            | ||                .||::..:: .|.....::..::..|..|:.: |::|.::....|
  Fly   416 HDFK----------------VLEDVWFTL-APELTVQSVELLMDSCPELQSVGQLNGWSLTPDDL 463

  Fly   355 NDAISLRKSEPVALVL 370
            .....|.||...::||
  Fly   464 ALIRGLLKSGNSSIVL 479

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12520NP_001097596.1 FBOX 11..44 CDD:197608 3/33 (9%)
CG15412NP_001259996.1 AMN1 <142..>228 CDD:187754 19/95 (20%)
leucine-rich repeat 145..168 CDD:275381 2/23 (9%)
leucine-rich repeat 169..196 CDD:275381 7/30 (23%)
leucine-rich repeat 197..224 CDD:275381 8/33 (24%)
leucine-rich repeat 225..252 CDD:275381 3/29 (10%)
leucine-rich repeat 253..275 CDD:275381 4/22 (18%)
leucine-rich repeat 369..393 CDD:275381 5/24 (21%)
leucine-rich repeat 394..416 CDD:275381 5/26 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR16134
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.