DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14120 and CG6839

Sequence 1:NP_648610.1 Gene:CG14120 FlyBaseID:FBgn0036321 Length:1371 Species:Drosophila melanogaster
Sequence 2:NP_649076.1 Gene:CG6839 FlyBaseID:FBgn0036831 Length:430 Species:Drosophila melanogaster

Alignment Length:381 Identity:169/382 (44%)
Similarity:238/382 (62%) Gaps:25/382 (7%)


  Fly   987 CSFKVNGDLKDPAPLFVVRSELGHARYLEPNQE--------GVVQLKHGEALEFHCINSFSGPFS 1043
            ||..:.|.|..|.|:           ||:.:.|        ||::.:.|.:|:..|.:.|:  ..
  Fly    57 CSVTIRGGLPSPEPV-----------YLKTDSEDFYPFSDVGVMEFESGGSLQLWCPSGFN--TH 108

  Fly  1044 GYTFVNSTCWQQQSILAMGSLYQLQDFVCTSWPTYTARRSGRPCNGGTDLLEVGFQLSSSSSDDF 1108
            ....:.::|....:....||.::.:|..|.|||.:.|.:||..||||. ::.|||:::||.   |
  Fly   109 SENLLTASCVSGTTFSVGGSNFEFKDLYCKSWPGFKAVKSGATCNGGI-VIRVGFEITSSR---F 169

  Fly  1109 LQTYDVCHDELSEVTRYVHHVLYPGSDQYQRSVSRPSFIPGDFYGGKDVNTLYTQVQQNITVSEI 1173
            .:...:|.:|..|||||..|.|.|||:.|:..|:|.:|....|:.||:|:.||||..|..|::..
  Fly   170 AEQMQICFNEEEEVTRYTRHKLEPGSNYYETGVARITFQTAGFFDGKNVDKLYTQATQLETINNE 234

  Fly  1174 LGMDASPYFNTTGNVYLARGHLSAKTDFVFGAAQKASFFFVNAAPQWQTFNGGNWERIEDSVRKF 1238
            ||.||..||:::.|||||||||.||.||.:...|:|:|.|:||||||||||.|||.|:||.:|.:
  Fly   235 LGGDAEKYFDSSSNVYLARGHLGAKADFDYAPEQRATFLFINAAPQWQTFNAGNWARVEDGLRAW 299

  Fly  1239 VADENITVDCYTGTWGVSTLPDVNGIGRELYLDFDENNNGLIPVPKLYFRVIIDRESRNGIVLLG 1303
            |:...:.|:||||.:||:|||:.:|:...|||..|:|||||||||||||||:||..|..|||.:|
  Fly   300 VSKNKLNVNCYTGVYGVTTLPNKDGVETPLYLAKDDNNNGLIPVPKLYFRVVIDPSSHRGIVFVG 364

  Fly  1304 VNNPHATIEQIEEEYIICQDIGAQLSWVSWTKEDLKKGYSYACTVEDFTAVVKDLP 1359
            |||||.|.|||:.:|:||.|:..|:::::|...|:|.|:||||.|.||...||.||
  Fly   365 VNNPHLTEEQIKRDYVICDDVSDQVTYINWKTTDIKAGWSYACEVADFLKTVKHLP 420

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14120NP_648610.1 NUC 164..416 CDD:238043
NUC 718..967 CDD:294067
NUC 1111..1359 CDD:238043 132/248 (53%)
CG6839NP_649076.1 NUC 170..420 CDD:238043 132/250 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131121779
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005351
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR13966
RoundUp 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.