DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14120 and CG14118

Sequence 1:NP_648610.1 Gene:CG14120 FlyBaseID:FBgn0036321 Length:1371 Species:Drosophila melanogaster
Sequence 2:NP_648612.1 Gene:CG14118 FlyBaseID:FBgn0036323 Length:439 Species:Drosophila melanogaster

Alignment Length:439 Identity:146/440 (33%)
Similarity:222/440 (50%) Gaps:48/440 (11%)


  Fly   953 SVEDFIEVVKDLPTDQLQTTGILGLTDQILDNEVCSFKVNGD---LKDPAPLFVVRSELGHARYL 1014
            ::.|..:::|||  |.|...|     :.......|...|..|   |....||::   ..|...|.
  Fly    26 TIPDVGQIIKDL--DGLHIDG-----EMFHQGSPCRVDVQNDLPRLDKVQPLYL---RPGTDLYW 80

  Fly  1015 EPNQEGVVQLKHGEALEFHCINSFSGPFSGYTF------VNSTCWQQQSILAMGSLYQLQDFVCT 1073
            .||..|.::::.|.::|.||.:||: |.:|.:.      :...|.|..:...||:.....||||.
  Fly    81 LPNAYGHLEVQRGASIELHCSHSFA-PANGESLDAKLRSIRVKCVQDTTFEWMGAKIHFSDFVCN 144

  Fly  1074 SWPTYTARRSGRPCNGGTD------LLEVGFQLSSSSSDDFLQTYDVCHDELSEVTRYVHHVLYP 1132
            ....||..|..|.|...|.      |..||:   .:....|:.|.::|||.....|.|.||.|.|
  Fly   145 HSMPYTVERLDRSCGSDTPSPSTSYLYRVGY---DTGDGRFVATMELCHDPNQLRTHYAHHQLTP 206

  Fly  1133 GSDQYQRSVSRPSFIPGDFYGGKDVNTLYT-QVQQNITVSEILGMDASPYFNTTGNVYLARGHLS 1196
            .:..:|:.:.||.|.....:.|.|:..:|: :.|:.:.|..::        :....::||||||:
  Fly   207 ANVHFQKKLKRPRFSTAGHFTGFDMARIYSPKSQEKLMVPGLI--------DVKSGLFLARGHLT 263

  Fly  1197 AKTDFVFGAAQKASFFFVNAAPQWQTFNGGNWERIEDSVRKFVADENITVDCYTGTWGVSTLPDV 1261
            ||.|.::.:.||:||.::|.|||||:||||.|.::|:|.|::||...||...|||.:|...:.. 
  Fly   264 AKADLIYASQQKSSFNYMNVAPQWQSFNGGQWSKLEESTRQYVARSGITATVYTGIYGEMKVAG- 327

  Fly  1262 NGIGRELYLDFDENNNGLIPVPKLYFRVIIDR-ESRNGIVLLGVNNPHATIEQIEEEYIICQDIG 1325
               .:.|::..:.||.|::.||:|::||:||. ....||.|:||||||||:.||.|.||||..:.
  Fly   328 ---SKVLHMTTNANNIGVVAVPQLFYRVLIDEGHPTRGIALVGVNNPHATLAQIHESYIICDPVE 389

  Fly  1326 AQLSWVSW-----TKEDLKKGYSYACTVEDFTAVVKDLPLQDLFVDGVL 1369
            ..:.|:||     .|.:||.||.|||:|.:....|..||...|.||.:|
  Fly   390 ESVQWLSWLHKSNAKGNLKNGYLYACSVANLARAVGHLPRPLLEVDELL 438

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14120NP_648610.1 NUC 164..416 CDD:238043
NUC 718..967 CDD:294067 4/14 (29%)
NUC 1111..1359 CDD:238043 97/255 (38%)
CG14118NP_648612.1 NUC 175..428 CDD:238043 98/268 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131121877
eggNOG 1 0.900 E1_2ANB2
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005351
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR13966
RoundUp 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.