DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14120 and CG12917

Sequence 1:NP_648610.1 Gene:CG14120 FlyBaseID:FBgn0036321 Length:1371 Species:Drosophila melanogaster
Sequence 2:NP_610558.2 Gene:CG12917 FlyBaseID:FBgn0033490 Length:356 Species:Drosophila melanogaster

Alignment Length:377 Identity:97/378 (26%)
Similarity:162/378 (43%) Gaps:62/378 (16%)


  Fly    43 VRGDCEF------KVNGDLNDPAPLFSRHNSYEIIVPDPTDTVRLVNGELLDMFCPGVGFAAPFV 101
            |.|||:.      :.||       :|:..::...|.....:||  .:|..|.::|      :|.|
  Fly    27 VHGDCQILQYMVEQSNG-------IFTYRDASGSIQLQRLETV--PSGVTLLVYC------SPSV 76

  Fly   102 NRWQVTATCLQNKYFLVDDLIYPFANFSCTAWPIFTALRSGKDCNGGTDLVQVGFEVEDGGFLQS 166
            .:..|   |..|..|.|.   .|....| ...|:...:|.| ||.|  :|..||:.: ||..|:.
  Fly    77 FKETV---CQDNGQFSVP---LPMRCLS-PMQPVTKHIRDG-DCAG--NLYAVGYTI-DGKDLEL 130

  Fly   167 YELCHDAEAEATRYVHHVLYPSSYDYQHGVARP--NFLELDFYGGRDVNTKYTQVQQNITISNIL 229
            |..|.|.......|....:|..::..:    ||  .|:..:.:..::. ..|.:.........|.
  Fly   131 YRTCFDCGQGRLVYSQSDVYYKTFFPK----RPFVEFVADEMFSPQEA-AAYMKSNIYFAFKCIY 190

  Fly   230 GLDASPYFNFSDDRILSRGHMIAKTDQIFGAAQHTTFLFINVAPQWQTFNGGNWEKVETSVRKFV 294
            |.|.| |...::..:::||||:|..|.:|.....:||.::||.||:::.|.|||||:|..||.  
  Fly   191 GDDQS-YLQNANYLVINRGHMVASADFLFTDQMGSTFRYLNVVPQFKSINDGNWEKIERWVRS-- 252

  Fly   295 ADRNLTTDCY----TGTWGVSTLPDVDGIERELYLDFDENNNGLIPVPKIYFRVVIDRVTREGI- 354
               .:....|    :|..|:.||||..|..:..:|     ....||||:..::.|.| .|..|: 
  Fly   253 ---QIPKSSYFRVKSGGIGILTLPDTRGFLQSAFL-----AGSKIPVPEWTYKAVRD-ATGNGLY 308

  Fly   355 VLIGINNPYLTLEQIQKDYILCQDIGHQLSWLTWYKEDLHEGYSYACSVEDF 406
            |.:..|:.:    |::|.  .|..|.:.::.......:.::||::.|..:.|
  Fly   309 VFLTYNSTF----QMEKP--PCLAICYPVNCPIHLPNNPNDGYTFCCDPKRF 354

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14120NP_648610.1 NUC 164..416 CDD:238043 64/251 (25%)
NUC 718..967 CDD:294067
NUC 1111..1359 CDD:238043
CG12917NP_610558.2 Endonuclease_NS 129..353 CDD:214889 62/247 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C2215620
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005351
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR13966
RoundUp 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.