DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14120 and Tengl3

Sequence 1:NP_648610.1 Gene:CG14120 FlyBaseID:FBgn0036321 Length:1371 Species:Drosophila melanogaster
Sequence 2:NP_608660.3 Gene:Tengl3 FlyBaseID:FBgn0051679 Length:337 Species:Drosophila melanogaster

Alignment Length:231 Identity:49/232 (21%)
Similarity:87/232 (38%) Gaps:57/232 (25%)


  Fly  1108 FLQTYDVCHDELSEVTR--YVH---HVLYP-----GSDQYQRSVSRPSFIPGDFYGGKD------ 1156
            |:|........|.::.|  ||:   |.|||     |:|...|..:||:.....|   ::      
  Fly    27 FVQQEASIRQLLQQIRRDPYVYHHRHKLYPMLSTFGTDHEARLWNRPTSWADKF---RELVLSPI 88

  Fly  1157 ---VNTLYTQVQQNITVSEILGMDASPY-FNTTGNVYLARGHLSA---------------KTDFV 1202
               |:...|....:.|.:::|  |...| ..:|.|:|:.:.::.:               :.|:.
  Fly    89 LDLVSATVTLKWDSATTTDLL--DLVKYGLPSTENLYVHKDYVVSQDLRTNGVRWICEHFRGDYQ 151

  Fly  1203 FGAAQKASFFFVN------------AAPQWQTFNGGNWERIEDSVRKFVADENITVDCYTGTWGV 1255
            ..::....:..:|            :....:.|....|..:|:.|.. :|.|..:|..|||....
  Fly   152 RVSSDGGGYSTMNLRYNDVYVLSCGSMSICKAFKRKIWNDLENYVSS-MAKEFGSVYAYTGPIYT 215

  Fly  1256 STLPDVNGIGRELYLDFDENNNGLIPVPKLYFRVII 1291
            .|..:: |.....|..||...   ||||..:|:|:|
  Fly   216 PTCYEI-GKWTMKYEVFDWIP---IPVPSHFFKVLI 247

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14120NP_648610.1 NUC 164..416 CDD:238043
NUC 718..967 CDD:294067
NUC 1111..1359 CDD:238043 47/229 (21%)
Tengl3NP_608660.3 Endonuclease_NS 125..294 CDD:214889 24/129 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR13966
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.