DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14120 and Tengl2

Sequence 1:NP_648610.1 Gene:CG14120 FlyBaseID:FBgn0036321 Length:1371 Species:Drosophila melanogaster
Sequence 2:NP_722779.1 Gene:Tengl2 FlyBaseID:FBgn0052463 Length:318 Species:Drosophila melanogaster

Alignment Length:304 Identity:70/305 (23%)
Similarity:104/305 (34%) Gaps:93/305 (30%)


  Fly   103 RWQ---------VTATC---LQNKYFLVDD-------LIY--PFANF-SCTAWPIFTALRS-GKD 144
            :||         |||.|   :...||...|       ||.  |:|.: |...:.:||...| .:|
  Fly     4 KWQLLGLGFVLGVTALCASFVGGMYFQHTDARKRLRELIQTDPYAYYLSPKIYEVFTFFESNNED 68

  Fly   145 CNGGTDLVQVGFE-VEDGGFLQSYELCHDAEAEATRYVHHVLYPSSYDYQHGVARPNFLELDFYG 208
            .:....:::.||. ::|......:.|.:|   ...|..|.|......|..|    ||       .
  Fly    69 DHRMRQIMKFGFPGLDDLRLYSDFVLSYD---RRNRVAHWVCEHLQADSIH----PN-------R 119

  Fly   209 GRDVNTKYTQVQQNITISNILGLDASPYFNFSDDRILSRGHMIAKTDQIFGAAQH--------TT 265
            ||.....|   |.::::.:....:.|.|.....|    |||:.|       |..|        .|
  Fly   120 GRRGRNPY---QPDLSVPSNFRSELSDYRRSGFD----RGHLAA-------AGNHHLQQNHCEDT 170

  Fly   266 FLFINVAPQ-WQTFNGGNWEKVETSVRKFVADRNLTTDC----YT------GTWGVSTLPDVDGI 319
            |...|:||| .|.||...|..:|..||..|........|    |.      |.|.|         
  Fly   171 FFLTNIAPQVGQGFNRSAWNNLEQYVRNLVHRFGSVFVCTGPLYKPNQRPGGKWAV--------- 226

  Fly   320 ERELYLDFDENNNGLIPVPKIYFRVV-------IDRVTREGIVL 356
                  :::.....::.||..:|:|:       :.:...||.||
  Fly   227 ------EYEMIGLNMVAVPTHFFKVIMVESKLHLGKPYMEGYVL 264

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14120NP_648610.1 NUC 164..416 CDD:238043 49/220 (22%)
NUC 718..967 CDD:294067
NUC 1111..1359 CDD:238043
Tengl2NP_722779.1 Endonuclease_NS 74..300 CDD:279553 52/235 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C2230088
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR13966
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.