DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14120 and ENDOG

Sequence 1:NP_648610.1 Gene:CG14120 FlyBaseID:FBgn0036321 Length:1371 Species:Drosophila melanogaster
Sequence 2:XP_011516649.1 Gene:ENDOG HGNCID:3346 Length:338 Species:Homo sapiens

Alignment Length:144 Identity:36/145 (25%)
Similarity:48/145 (33%) Gaps:43/145 (30%)


  Fly   165 QSYELCHDAEAEATRYVHHVLYPSSYDYQHGVARPNFL-------ELDFYGGRDVNTKYTQVQQN 222
            :||.||:|.......:|...|            ||..|       |.||.....|:..:.....:
Human   168 ESYVLCYDPRTRGALWVVEQL------------RPERLRGDGDRRECDFREDDSVHAYHRATNAD 220

  Fly   223 ITISNILGLDASPYFNFSDDRILSRGHMIAKTDQIFG-AAQHTTFLFINVAPQWQTFNGGNWEKV 286
            ...|   |.|              |||:.|..:..:. .|...||...|||||....|...|..:
Human   221 YRGS---GFD--------------RGHLAAAANHRWSQKAMDDTFYLSNVAPQVPHLNQNAWNNL 268

  Fly   287 ETSVRKFVADRNLT 300
            |    |:  .|:||
Human   269 E----KY--SRSLT 276

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14120NP_648610.1 NUC 164..416 CDD:238043 36/145 (25%)
NUC 718..967 CDD:294067
NUC 1111..1359 CDD:238043
ENDOGXP_011516649.1 NUC 167..>295 CDD:214683 36/145 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR13966
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.