DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14120 and Endog

Sequence 1:NP_648610.1 Gene:CG14120 FlyBaseID:FBgn0036321 Length:1371 Species:Drosophila melanogaster
Sequence 2:NP_031957.1 Gene:Endog MGIID:1261433 Length:294 Species:Mus musculus

Alignment Length:278 Identity:62/279 (22%)
Similarity:97/279 (35%) Gaps:64/279 (23%)


  Fly  1053 WQQQSILAMGSL--YQLQDFVCTSWPTYTARRSGRPCNGGTDLLEVGF----QLSSSSSDDFLQT 1111
            |:::...|.|.|  ..|...|....|..    .|.|..|..:|.:.|.    ||.|..|      
Mouse    23 WRRREGKAPGLLGRVPLLPVVAADLPAL----PGGPAGGTGELAKYGLPGVAQLRSRES------ 77

  Fly  1112 YDVCHDELSEVTRYVHHVLYPGSDQYQRSVSRPSFIPG-------DFYGGKDVNTLYTQVQQNIT 1169
            |.:.:|..:....:|...|            ||..:.|       ||.....|:..:.....:..
Mouse    78 YVLSYDPRTRGALWVLEQL------------RPERLRGDGDRSACDFREDDSVHAYHRATNADYR 130

  Fly  1170 VSEILGMDASPYFNTTGNVYLARGHLSAKTDFVFGAAQKA---SFFFVNAAPQWQTFNGGNWERI 1231
            .|   |.|              ||||:|..:..:  :|:|   :|:..|.|||....|...|..:
Mouse   131 GS---GFD--------------RGHLAAAANHRW--SQRAMDDTFYLSNVAPQVPHLNQNAWNNL 176

  Fly  1232 EDSVRKFVAD-ENITVDCYTGTWGVSTLPDVNGIGRELYLDFDENNNGLIPVPKLYFRVIIDRES 1295
            |...|..... :|:.| |    .|...||.....|:. |:.:.......:.||..:|:|:|...:
Mouse   177 ERYSRSLTRTYQNVYV-C----TGPLFLPRTEADGKS-YVKYQVIGKNHVAVPTHFFKVLILEAA 235

  Fly  1296 RNGIVLLGVNNPHATIEQ 1313
            ...|.|.....|:|.:::
Mouse   236 GGQIELRSYVMPNAPVDE 253

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14120NP_648610.1 NUC 164..416 CDD:238043
NUC 718..967 CDD:294067
NUC 1111..1359 CDD:238043 46/215 (21%)
EndogNP_031957.1 NUC1 29..278 CDD:224777 61/273 (22%)
NUC 75..281 CDD:214683 47/223 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR13966
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.