DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14120 and endog

DIOPT Version :9

Sequence 1:NP_648610.1 Gene:CG14120 / 39463 FlyBaseID:FBgn0036321 Length:1371 Species:Drosophila melanogaster
Sequence 2:NP_001019385.1 Gene:endog / 100002293 ZFINID:ZDB-GENE-050522-402 Length:306 Species:Danio rerio


Alignment Length:231 Identity:50/231 - (21%)
Similarity:85/231 - (36%) Gaps:51/231 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly  1117 DELSEVTRYVHHVLYPGSDQYQRSV--------------SRPSFIPGDFYGGKDVNTLYTQVQQN 1167
            |..||::.|     .||.....||.              ||.|::..  |..:  |.....|.:.
Zfish    54 DAASEISPY-----QPGQVSVNRSTAAMKYGFPSLSNIKSRESYVTS--YDPR--NRTAAWVIEQ 109

  Fly  1168 ITVSEILGMDASPY--FNTTGNVYL--------------ARGHLSAKTDFVFGAAQKA---SFFF 1213
            :....:.|.....|  |....:|::              .||||:|..:..:  :|||   :|:.
Zfish   110 LNAETVTGSSDRKYCEFKEDESVHVYHRSSNADYKGSGFDRGHLAAAANHKW--SQKAMDETFYL 172

  Fly  1214 VNAAPQWQTFNGGNWERIEDSVRKFVAD-ENITVDCYTGTWGVSTLPDVNGIGRELYLDFDENNN 1277
            .|.:||....|...|..:|...|..... :|:.| |    .|...||.....|: :|:.:.....
Zfish   173 SNVSPQNPNLNQNAWNNLEKYCRSLTKHYQNVFV-C----TGPLYLPRQEADGK-MYVKYQVLGK 231

  Fly  1278 GLIPVPKLYFRVIIDRESRNGIVLLGVNNPHATIEQ 1313
            ..:.||..:|:|:|..:.|..:.|.....|:..:::
Zfish   232 NHVAVPTHFFKVVILEKPRGDVELRSYVMPNMPVDE 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14120NP_648610.1 NUC 164..416 CDD:238043
NUC 718..967 CDD:294067
NUC 1111..1359 CDD:238043 50/231 (22%)
endogNP_001019385.1 NUC 89..293 CDD:214683 41/191 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.