DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Wbp2 and AT5G11680

Sequence 1:NP_648607.3 Gene:Wbp2 FlyBaseID:FBgn0036318 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_196729.1 Gene:AT5G11680 AraportID:AT5G11680 Length:207 Species:Arabidopsis thaliana

Alignment Length:171 Identity:45/172 (26%)
Similarity:68/172 (40%) Gaps:30/172 (17%)


  Fly     1 MSVNTAHANNGVLI-HAGEYILLHSDSVSMEFSGQDNPIFKGSKGGR------IYLTSHRMIFNS 58
            |::|.....||:.: ...|..:|..|.|  ||.....|   |..||.      |||::.||:|.|
plant     1 MALNPQLLPNGMPVPFVNEMFVLVRDGV--EFEVDKIP---GGHGGHVKAKGVIYLSNIRMVFVS 60

  Fly    59 KKSSDSMQSFSAPFVALSDVEIEQPVFGANYIKGKVR-AQPNGNY---VGEVKFKLHFKAGG--- 116
            .|..|:..:|..|.:.:...:..||:|..|.|.|:|. ..|...:   .....||:.||.||   
plant    61 SKPVDNFVAFDMPLLYIHAEKFNQPIFHCNNIAGQVEPVVPENEHRALYSTHSFKILFKEGGCGT 125

  Fly   117 -----------AIEYGQALLRSAKTAMNNYHRGGLAGDDPP 146
                       ..:|.:.:.::|:.|....|...|.....|
plant   126 FVPLFLNLISSVRQYNRQMQQAAEAAAAAPHVDPLQAAQTP 166

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Wbp2NP_648607.3 PH-GRAM_WBP2 27..129 CDD:275401 34/126 (27%)
AT5G11680NP_196729.1 PH-GRAM_WBP2 29..135 CDD:275401 31/109 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T192525
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR31606
Phylome 1 0.910 0.750 Consistency score
44.010

Return to query results.
Submit another query.