DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Wbp2 and Wbp2nl

Sequence 1:NP_648607.3 Gene:Wbp2 FlyBaseID:FBgn0036318 Length:384 Species:Drosophila melanogaster
Sequence 2:XP_017172261.1 Gene:Wbp2nl MGIID:1921966 Length:376 Species:Mus musculus

Alignment Length:381 Identity:123/382 (32%)
Similarity:167/382 (44%) Gaps:90/382 (24%)


  Fly    20 ILLHSDSVSMEF--SGQDNPIFKGSKGGRIYLTSHRMIF-NSKKSSDSMQSFSAPFVALSDVEIE 81
            :|.....|.:.|  |...:.:|.|:|.|.::|||:|:|| .|:..:|.|.||:.||..:::..:|
Mouse    39 LLKKCSEVDLSFPQSPPGSNLFSGTKRGALFLTSYRVIFVTSRADNDPMFSFTMPFHLMNNCTVE 103

  Fly    82 QPVFGANYIKGKVRAQPNGNYVGEVKFKLHFKAGGAIEYGQALLRSAKTA-------MNNYHRGG 139
            ||:||||||||.::|.|:|.:.|...||:.|:.||||::.|.:.::|..|       :.::..|.
Mouse   104 QPIFGANYIKGTIQAAPDGGWEGSATFKIVFRKGGAIDFAQLMAKAASAAAQGVPLRVASFWMGP 168

  Fly   140 LAGDDPPPYQPAGSWNEAPPPAYQ-----PPPGY------YGWLPQHDAFSGPAPNTVYMSDNPP 193
            |.     .|...|..|...|.|||     ||.||      ||           .|:..|   ..|
Mouse   169 LG-----IYVITGDRNMYAPQAYQVAYGAPPAGYGASPVGYG-----------VPSAGY---GAP 214

  Fly   194 PYPGIAPPAHQPAPQQPQAPSSNE-PNWYG---FSAPPPQQQQQQPGYG--PQGWAGGYVQPPP- 251
            |....|||....||    :|..:. |..||   :.:|||.......|||  |.|:.     ||| 
Mouse   215 PAGYGAPPVGYVAP----SPGYDVLPPGYGAVRYGSPPPLYVATPMGYGVPPPGYG-----PPPV 270

  Fly   252 -YASCAPNCPPQPPYAAPAQTYNGPQPYGGYGNVPGGFNT--PGFQQPNGNPNGYPGGPP----- 308
             |.|      |.|.|.||...| |.|| ..||..|.|..:  |.::.|   |.|| |.||     
Mouse   271 RYGS------PPPGYEAPTMEY-GAQP-PRYGTTPMGSGSPPPRYEAP---PMGY-GTPPSGRES 323

  Fly   309 -PPGQQAAGAAGGAAASGASFMGFSLPPGNSKEAEAAASAYNTPYNQGG-PSGSGN 362
             |||.:|...|..|            ||..|:.....:.|...|..|.. ||.|.:
Mouse   324 IPPGSRATSVAQEA------------PPAGSEAGHPMSVAVQNPEFQASFPSTSSS 367

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Wbp2NP_648607.3 PH-GRAM_WBP2 27..129 CDD:275401 44/105 (42%)
Wbp2nlXP_017172261.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C248149721
eggNOG 1 0.900 E1_KOG3294
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001789
OrthoInspector 1 1.000 T616893
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR31606
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.800

Return to query results.
Submit another query.