DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Wbp2 and Wbp2nl

Sequence 1:NP_648607.3 Gene:Wbp2 FlyBaseID:FBgn0036318 Length:384 Species:Drosophila melanogaster
Sequence 2:XP_017450756.1 Gene:Wbp2nl RGDID:1586458 Length:400 Species:Rattus norvegicus

Alignment Length:395 Identity:120/396 (30%)
Similarity:164/396 (41%) Gaps:98/396 (25%)


  Fly    20 ILLHSDSVSMEFSGQDNP---IFKGSKGGRIYLTSHRMIF-NSKKSSDSMQSFSAPFVALSDVEI 80
            :|.....|.:.|. |..|   :|.|:|.|.::|||:|:|| .|:..:|.|.||..||..:::..|
  Rat    63 VLKKCSDVDLSFP-QPRPGSNLFSGTKRGTVFLTSYRVIFVTSRSDNDPMLSFMMPFHLMNNCTI 126

  Fly    81 EQPVFGANYIKGKVRAQPNGNYVGEVKFKLHFKAGGAIEYGQALLRSAKTA-------MNNYHRG 138
            |||:||||||||.::|.|:|.:.|...||:.|:.||||::.|.:.::|..|       :.::..|
  Rat   127 EQPIFGANYIKGTIQAAPDGGWEGSATFKIVFRKGGAIDFAQLMAKAASAAAQGVPLRVASFWMG 191

  Fly   139 GL-----AGD----DPPPYQPAGSWNEAPPPAYQPPPGYYGWLPQHDAFSGPAPNTVYMSDNPPP 194
            .|     .|:    .|..||.|..   ||...|..||..||                    .||.
  Rat   192 PLGIYVITGERNIYAPQAYQAAYG---APHAGYGVPPAGYG--------------------VPPA 233

  Fly   195 YPGIAPPAHQPAPQQPQAPSSNEPNWYGFSAPPPQQQQQQPGYGPQGWAGGYVQPPPYASCAPNC 259
            ..|:.|..:...|.             |:.||||:......|||    |..|..|||.....|  
  Rat   234 GYGVPPAGYGVLPA-------------GYGAPPPRYDVLPSGYG----AARYGSPPPLYVATP-- 279

  Fly   260 PPQPPYAAPAQTYNGPQPYGGYGNVPGGFNTPGFQQPNGNPNGY-----PGGPPPPGQQAAGAAG 319
               ..|..|...| ||.|. .||:.|.|:..|..|. ...|..|     ..|.||||.:|.....
  Rat   280 ---MGYGVPPPGY-GPPPV-RYGSPPPGYEAPTMQY-GAPPPTYVTTPMESGSPPPGYEAPPIGF 338

  Fly   320 GAAASGASFMGFSLPPGN-----SKEAEAAAS---------AYNTPYNQGGPSGSGNNDLPPSYN 370
            |...||:.    |:|.|:     ::||..|.|         |.|..:....||.|.      |.:
  Rat   339 GTPGSGSE----SIPSGSTSLPVAQEALPAGSEAGHPTSVAAQNPEFQASFPSTSS------SQS 393

  Fly   371 NLPPS 375
            :.|||
  Rat   394 HSPPS 398

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Wbp2NP_648607.3 PH-GRAM_WBP2 27..129 CDD:275401 46/106 (43%)
Wbp2nlXP_017450756.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C248145823
eggNOG 1 0.900 E1_KOG3294
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001789
OrthoInspector 1 1.000 T619004
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR31606
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
87.800

Return to query results.
Submit another query.