DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Wbp2 and wbp2

Sequence 1:NP_648607.3 Gene:Wbp2 FlyBaseID:FBgn0036318 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001018380.2 Gene:wbp2 ZFINID:ZDB-GENE-050522-137 Length:264 Species:Danio rerio

Alignment Length:286 Identity:105/287 (37%)
Similarity:135/287 (47%) Gaps:63/287 (22%)


  Fly     1 MSVNTAHANNG-VLIHAGEYILLHSDSVSMEFSGQDN--PIFKGSKGGRIYLTSHRMIFNSKKSS 62
            |::|..|..:| |:|:..|.:|:..::|.:.||..:.  ..|:.||.|.||||.:|:||.: |..
Zfish     1 MALNKNHDESGRVIINNFEGVLMSYENVELVFSDSERLPDAFRKSKKGSIYLTPYRVIFLT-KGK 64

  Fly    63 DSMQSFSAPFVALSDVEIEQPVFGANYIKGKVRAQPNGNYVGEVKFKLHFKAGGAIEYGQALLRS 127
            |.:|||..||..:...|::|||.|||||||.|.|:..|.:.|...|||.|.||||||:||.:|..
Zfish    65 DPLQSFMMPFYLMKGCEVKQPVLGANYIKGTVGAESGGGWEGSATFKLIFSAGGAIEFGQRMLHV 129

  Fly   128 AKTAMNN----------YHRGGLAGDDPPP----YQPAGSWNEAPPPAY----QPPPGYYGWLPQ 174
            |:.|...          |...|.....|||    ..|||    .|||.|    .||||  |:.|.
Zfish   130 AEQASRGQPVTVNFGCPYMANGAYAFPPPPPANGMYPAG----PPPPGYAYPGPPPPG--GFYPS 188

  Fly   175 HDAFSGPAPNTVYMSDNPPPYPGIAPPAHQPA-PQQPQ-----------APSSNEPNWYGFSAPP 227
            ...|.|||   .||.  ||||  .||..|.|. |..|:           |.||:....|   ||.
Zfish   189 PPVFDGPA---AYMP--PPPY--TAPVDHAPLDPDLPRTAAAEAKAAEAAASSSANTTY---APT 243

  Fly   228 PQQQQQQPGYGPQGWAGGYVQPPPYA 253
            ..       |.|:.      :||||:
Zfish   244 HV-------YLPED------KPPPYS 256

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Wbp2NP_648607.3 PH-GRAM_WBP2 27..129 CDD:275401 50/104 (48%)
wbp2NP_001018380.2 PH-GRAM_WBP2 30..131 CDD:275401 49/102 (48%)
WWbp 100..>164 CDD:287338 22/64 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C248152113
eggNOG 1 0.900 E1_KOG3294
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 131 1.000 Inparanoid score I4537
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001789
OrthoInspector 1 1.000 T597766
orthoMCL 1 0.900 OOG5_132815
Panther 1 1.100 LDO PTHR31606
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1809
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1110.780

Return to query results.
Submit another query.