DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Wbp2 and Wbp2

Sequence 1:NP_648607.3 Gene:Wbp2 FlyBaseID:FBgn0036318 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_620431.1 Gene:Wbp2 RGDID:620032 Length:262 Species:Rattus norvegicus

Alignment Length:391 Identity:125/392 (32%)
Similarity:157/392 (40%) Gaps:140/392 (36%)


  Fly     1 MSVNTAHA-NNGVLIHAGEYILLHSDSVSMEFSGQDN--PIFKGSKGGRIYLTSHRMIFNSKKSS 62
            |::|..|: ..||:::..|.||:..|.|.:.|:...|  ..|||:|.|.:|||.:|:||.| |..
  Rat     1 MALNKNHSEGGGVIVNNTESILMSYDHVELTFNDMKNVPEAFKGTKKGTVYLTPYRVIFLS-KGK 64

  Fly    63 DSMQSFSAPFVALSDVEIEQPVFGANYIKGKVRAQPNGNYVGEVKFKLHFKAGGAIEYGQALLRS 127
            |:|:||..||..:.|.|::|||||||:|||.|:|:..|.:.|...:||.|.||||||:||.:|:.
  Rat    65 DAMRSFMMPFYLMKDCEVKQPVFGANFIKGTVKAEAGGGWEGSASYKLTFTAGGAIEFGQQMLQV 129

  Fly   128 AKTAMNNYHRGGLAGDDPPPYQPAGSWNEAPPPA---YQPPPGYYGWLPQHDAFSGPAPNTVYMS 189
            |..|.......|..|   .||.|:|::...||.|   |..||||            |.|      
  Rat   130 ASQASRGEVPNGAYG---YPYMPSGAYVFPPPVANGMYPCPPGY------------PYP------ 173

  Fly   190 DNPPP---YPGIAPPAHQPAPQQPQAPSSNEPNWYGFSAPPPQQQQQQPGYGPQGWAGGYVQPPP 251
              |||   |||                             ||...          .|.|||||||
  Rat   174 --PPPPEFYPG-----------------------------PPMMD----------GAMGYVQPPP 197

  Fly   252 YASCAPNCPPQPPYAAPAQTYNGPQPYGGYGNVPGGFNTPGFQQPNGNPNGYPGGPPPPGQQAAG 316
                       |||..|.:    |....|                       |..||.|..:|  
  Rat   198 -----------PPYPGPME----PPVVSG-----------------------PSAPPTPAAEA-- 222

  Fly   317 AAGGAAASGASFMGFSLPPGNSKEAEAAASAYNTPYNQGGPSGSGNNDLPPSYNNLPPSYDDASK 381
                                  |.||||||||   ||.|.|.   |..:|.|....||.|....|
  Rat   223 ----------------------KAAEAAASAY---YNPGNPH---NVYMPTSQPPPPPYYPPEDK 259

  Fly   382 K 382
            |
  Rat   260 K 260

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Wbp2NP_648607.3 PH-GRAM_WBP2 27..129 CDD:275401 51/104 (49%)
Wbp2NP_620431.1 PH-GRAM_WBP2 30..131 CDD:275401 50/103 (49%)
PPxY motif 1 196..200 2/4 (50%)
PPxY motif 2 249..253 3/4 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C248153407
eggNOG 1 0.900 E1_KOG3294
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 149 1.000 Inparanoid score I4233
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001789
OrthoInspector 1 1.000 T619004
orthoMCL 1 0.900 OOG5_132815
Panther 1 1.100 LDO PTHR31606
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.890

Return to query results.
Submit another query.