DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Wbp2 and D2013.6

Sequence 1:NP_648607.3 Gene:Wbp2 FlyBaseID:FBgn0036318 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_495987.1 Gene:D2013.6 WormBaseID:WBGene00008404 Length:235 Species:Caenorhabditis elegans

Alignment Length:251 Identity:96/252 (38%)
Similarity:131/252 (52%) Gaps:27/252 (11%)


  Fly     1 MSVNTAHANN--GVLIHAGEYILLHSDSVSMEFSGQDNPIFKGSKGGRIYLTSHRMIFNSKKSSD 63
            ||:|||:..:  |||::.||.|::.:..|.|.....:|...:|.:.|.|||||||:|| .....|
 Worm     1 MSINTANTPDGLGVLLYNGETIVIFAQGVVMTLGTSENENLEGRRTGTIYLTSHRIIF-MPDPGD 64

  Fly    64 SMQSFSAPFVALSDVEIEQPVFGANYIKGKVRAQPNGNYVGEVKFKLHFKAGGAIEYGQALLRSA 128
            .::||..||.::.||.:.||:|||||:.|...|...|...||||:::.|..||.||:||:||::.
 Worm    65 WLKSFEIPFNSMQDVNLNQPIFGANYLCGIASAVQGGQMRGEVKWRMTFNRGGCIEFGQSLLQAV 129

  Fly   129 KTAMNNYHRGGLAGDDPPPYQ-PAGSWNEAPPPAYQPPP--GYYGWLPQHDAF-SGPAPNTVYMS 189
            :.|:.......     ||.|. |.|.:..|||..|||.|  |..|:.|..|:| ..|.|:.|:||
 Worm   130 ERAVRMRPENA-----PPAYSPPIGDFYSAPPAYYQPSPDQGPNGFNPTTDSFPDQPNPSRVFMS 189

  Fly   190 DNPPPYPGIAPPAHQPAPQQPQAPSSNEPNWYGFSAPPPQQQQQQPGYGPQGWAGG 245
            ..|||||||. |...|.|.:....:..      |.||        |.||....|.|
 Worm   190 SAPPPYPGIG-PERGPHPTEELHVAGQ------FEAP--------PAYGSGETADG 230

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Wbp2NP_648607.3 PH-GRAM_WBP2 27..129 CDD:275401 44/102 (43%)
D2013.6NP_495987.1 PH-GRAM_WBP2 29..130 CDD:275401 44/102 (43%)
WWbp 100..200 CDD:287338 44/106 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C248103213
eggNOG 1 0.900 E1_KOG3294
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H136690
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001789
OrthoInspector 1 1.000 T375156
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR31606
Phylome 1 0.910 0.706 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1809
TreeFam 1 0.960
98.830

Return to query results.
Submit another query.