DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Wbp2 and WBP2NL

Sequence 1:NP_648607.3 Gene:Wbp2 FlyBaseID:FBgn0036318 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_689826.2 Gene:WBP2NL HGNCID:28389 Length:309 Species:Homo sapiens

Alignment Length:376 Identity:120/377 (32%)
Similarity:164/377 (44%) Gaps:85/377 (23%)


  Fly     1 MSVNTAHANN--GVLIHAGEYILLHSDSVSMEF--SGQDNPIFKGSKGGRIYLTSHRMIF-NSKK 60
            |:||.:|..|  |.||..||.:|..|.:|.:.|  ..:.:.:|.|.|.|.::|||:|:|| .|..
Human     1 MAVNQSHTENRRGALIPNGESLLKRSPNVELSFPQRSEGSNVFSGRKTGTLFLTSYRVIFITSCS 65

  Fly    61 SSDSMQSFSAPFVALSDVEIEQPVFGANYIKGKVRAQPNGNYVGEVKFKLHFKAGGAIEYGQALL 125
            .||.|.||..||..::::.:|||||.||:|||.::|.|.|.:.|:..|||.|:.|.|||:.|.::
Human    66 ISDPMLSFMMPFDLMTNLTVEQPVFAANFIKGTIQAAPYGGWEGQATFKLVFRNGDAIEFAQLMV 130

  Fly   126 RSAKTAMNNYHRGGLAGDDPPPYQPAGSWNEAPPPAYQPPPGYYGWLPQHDAFSGPAPNTVYMSD 190
            ::|..|...:           |.:....|..:        .|.|....:.:..:...|.:|.:..
Human   131 KAASAAARGF-----------PLRTLNDWFSS--------MGIYVITGEGNMCTPQMPCSVIVYG 176

  Fly   191 NPPPYPGIAPPAHQPAPQQPQAPSSNEPNWYGFSAPPPQQQQQQPGYG--PQGWAGGYVQPPPYA 253
            .||...|..||                    |:.|||       .|||  |.|..|    ||...
Human   177 APPAGYGAPPP--------------------GYGAPP-------AGYGAQPVGNEG----PPVGY 210

  Fly   254 SCAPNCPPQPP--YAAPAQTYNGPQPYGGYGNVPGGFNTP--GFQQPNGNPNGYPGGPPPPGQQA 314
            ..:|.....||  |.||...|..| |. |||..|.|:.||  |:..|   |.||  |.||.|.:.
Human   211 RASPVRYGAPPLGYGAPPAGYGAP-PL-GYGAPPLGYGTPPLGYGAP---PLGY--GAPPAGNEG 268

  Fly   315 --AGAAGGAAASGASFMGFSLPPGNSKEAEAAASAYNTPYNQGG-PSGSGN 362
              ||.....|.|||.       |..|..|:|       |.|:.. ||.|.:
Human   269 PPAGYRASPAGSGAR-------PQESTAAQA-------PENEASLPSASSS 305

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Wbp2NP_648607.3 PH-GRAM_WBP2 27..129 CDD:275401 44/105 (42%)
WBP2NLNP_689826.2 PH-GRAM_WBP2 39..134 CDD:275401 42/95 (44%)
WWbp 103..263 CDD:287338 60/217 (28%)
10 X 7 AA tandem repeat of Y-G-X-P-P-X-G 175..265 41/128 (32%)
PPxY motif 186..189 3/23 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C248151492
eggNOG 1 0.900 E1_KOG3294
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001789
OrthoInspector 1 1.000 T610089
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR31606
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
87.800

Return to query results.
Submit another query.