DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42588 and TFC6

DIOPT Version :8

Sequence 1:NP_648604.2 Gene:CG42588 / 39457 FlyBaseID:FBgn0260965 Length:2730 Species:Drosophila melanogaster
Sequence 2:NP_010649.1 Gene:TFC6 / 851964 SGDID:S000002770 Length:672 Species:Saccharomyces cerevisiae

Alignment Length:1050 Identity:180/1050 (17%)
Similarity:289/1050 (28%) Gaps:451/1050 (43%)


  Fly  1739 IVPPVSQPKPEKLHEQNRDESVRA--PKEQLDPTTSKNSRGKRQSRSIA---------------- 1785
            ::|...:.:|.|        ||.|  |.:.|....|:||..||..|:.:                
Yeast     3 VIPAKKRGRPRK--------SVVAEVPYDSLASPVSENSGSKRPRRNASKKAVANFAQLVHAGRD 59

  Fly  1786 -ATNTPTTMLTTASEDPEAV--------EGDSVEVPIKRKASTRRGSVPRDTPISSVNASDESAV 1841
             ..||........::|.:.|        |.|:||:..:.:..:.:..|      :.:|:|...| 
Yeast    60 DVINTTQVNNVDDTDDDDFVLNDEGDGEESDNVEIEFENELESTKNEV------ADLNSSGSGA- 117

  Fly  1842 LESVPKKGRRSNISSVPADTTIPKSSKSDSLNAIEIIPPICEEPKVVPSKRGRKRAAPSDIETGL 1906
              ||...|||:.:..:.......|:.||.|             |.....::||......|:.:..
Yeast   118 --SVRPSGRRNTVQKLRLKKNSTKNMKSSS-------------PGSSLGQKGRPIRLLKDLSSAR 167

  Fly  1907 AKKLKTEESSETERVVDFNLR--LLLIRKRDQLDTDEVLTNDGKGQGPLQCGLCLVRSDKNNWQR 1969
            .|         .||:...|..  |||.:.::..:|.                             
Yeast   168 DK---------IERIYGLNKEKLLLLAKVKEGFETS----------------------------- 194

  Fly  1970 HIGEHYGVGWLVGETP-KNITRSGIMTMMKNYLQKNGGKLTCRLCNHQLGSYLGMMLHLEGCGNK 2033
                       |.:.| |||             |.:.....|                       
Yeast   195 -----------VFDFPFKNI-------------QPDSPYFVC----------------------- 212

  Fly  2034 QRFQCEFCQRSYTKLSLPVHIRTCPKRIAPQVTEDPEDADGDCKETVFSNAGRAKRKSTIKAETK 2098
                          |..|     |.|..|      .....||...||:....:.:.::.||..||
Yeast   213 --------------LDPP-----CKKESA------YNKVIGDKNRTVYHEINKTEFENMIKLRTK 252

  Fly  2099 LKK--IGEALTTQKSGEGASAKNDFDGDSSDYDLTKDKESSEEYDSEGVDSNEDSISSEGEGSLG 2161
            ..|  |||.                                                 :.|.|.|
Yeast   253 RLKLLIGEV-------------------------------------------------DAEVSTG 268

  Fly  2162 DNFSTSKQSKANRRGDIDRKRICNRPVNVGECQQKPLLSRYHHLEARATHKWNEFVQRNYEAGAL 2226
            |.......:...|||.|                                          |..|.|
Yeast   269 DKIEFPVLANGKRRGFI------------------------------------------YNVGGL 291

  Fly  2227 FTQLVPSYSKIPEKNTDGMLPPKNTPSMRYSYGKVKNEDDWKQLAPFEGFNKEGEYVGYLGSSIK 2291
            .|.:  ::..| |:|||                                          :|..|:
Yeast   292 VTDI--AWLNI-EENTD------------------------------------------IGKDIQ 311

  Fly  2292 KLEWVPLPPKAASQYLLCSVRSKMKTFARHK--------KLKDEDGLLMLLKCTAKNAGKSWTLR 2348
            .|      ..|.|||:...:...::.|.:.|        |:.......:.::....:.|:.|.|:
Yeast   312 YL------AVAVSQYMDEPLNEHLEMFDKEKHSSCIQIFKMNTSTLHCVKVQTIVHSFGEVWDLK 370

  Fly  2349 PELHYCVHVPNGPIHSFSFLPSGGYDKSSNRLGVLAVANSLSSVHIY------ALPLELANDEID 2407
              .|...|.|: .:...||:...|      .:..|.:.::.:.||::      :|.|.||     
Yeast   371 --WHEGCHAPH-LVGCLSFVSQEG------TINFLEIIDNATDVHVFKMCEKPSLTLSLA----- 421

  Fly  2408 ENADEKVVIQLDSLITLTLDINNPVQDQCTKICWSLSAGHSFLATGYSSGHFALWDIGEKDNLNC 2472
                       ||||| |.|..:|.    |.:|            |:.:|..|.:|:.:.:    
Yeast   422 -----------DSLIT-TFDFLSPT----TVVC------------GFKNGFVAEFDLTDPE---- 454

  Fly  2473 FIRNNQTHFVP-----VNFLYIGERNVQYMDLHYDNNGPRWLAVGTSIRQFKIYDIANWSNPYIL 2532
                     ||     |:..||...:..|.|  :::.....:||......|...|||.       
Yeast   455 ---------VPSFYDQVHDSYILSVSTAYSD--FEDTVVSTVAVDGYFYIFNPKDIAT------- 501

  Fly  2533 TQDTISSLYMANLTWSPICEALVVSSSHFFRTIAVS----PSGIQFEHRTLDGTLTTTREMHTNC 2593
            |:.|:|....:||.....|..:.   |:.:...|.|    ||...|....|....||        
Yeast   502 TKTTVSRFRGSNLVPVVYCPQIY---SYIYSDGASSLRAVPSRAAFAVHPLVSRETT-------- 555

  Fly  2594 QQNHMVFVTDNGDLVFLDVRNLNCGPALLKSTVNSRAVSTTELHHL--GSSAPSATD-------- 2648
                         :..:.|..|:  |.:|..:.:...:.|.....|  |....|||.        
Yeast   556 -------------ITAIGVSRLH--PMVLAGSADGSLIITNAARRLLHGIKNSSATQKSLRLWKW 605

  Fly  2649 --PIDPDEFVRDYGLQINPLVPEPHKRKSTYLSAKRRPQNIHSLAMTRFNCVRCNWNSPTHTWVA 2711
              .|..|::..|...::.||         |.....:...:.|.:.:|   |.:.|..|......|
Yeast   606 DYSIKDDKYRIDSSYEVYPL---------TVNDVSKAKIDAHGINIT---CTKWNETSAGGKCYA 658

  Fly  2712 MGAEHGMLRI 2721
            .....|:|.:
Yeast   659 FSNSAGLLTL 668

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42588NP_648604.2 PHA03247 <11..541 CDD:223021
WD40 repeat 2363..2403 CDD:293791 10/46 (22%)
WD40 repeat 2437..2477 CDD:293791 6/40 (15%)
WD40 repeat 2484..2533 CDD:293791 11/49 (22%)
WD40 repeat 2541..2588 CDD:293791 12/51 (24%)
TFC6NP_010649.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR15052
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.