DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG42588 and Gtf3c2

Sequence 1:NP_648604.2 Gene:CG42588 FlyBaseID:FBgn0260965 Length:2730 Species:Drosophila melanogaster
Sequence 2:NP_082177.2 Gene:Gtf3c2 MGIID:1919002 Length:907 Species:Mus musculus

Alignment Length:801 Identity:166/802 (21%)
Similarity:271/802 (34%) Gaps:245/802 (31%)


  Fly  2062 APQVTEDPEDADGDCKETVFSNAGRAKRKSTIKAETKLKKIGEALTT------------------ 2108
            :|.....|||.:....|       |.:|::...|...|:::.|.|:|                  
Mouse   163 SPHPKRPPEDFETPSGE-------RPRRRAAQVALLYLQELAEELSTALPAPPLSGPKSPKVSSP 220

  Fly  2109 --QKSGEGASAKNDFDGDSSDYDLTKDKESSEEYDSEGVDSNEDSISSEGEGSLGDNFSTSKQSK 2171
              .|....||::.:.||.:.|.|.....|..:|.:||....|    ||:.|.....  ||.:...
Mouse   221 TKPKKTRQASSQGEEDGSARDEDFVLQVEGEDEEESEAPSEN----SSDPEPVAPR--STPRGPA 279

  Fly  2172 ANRRGDIDRKRICNRPVN-----VGECQQ--KPLLSRYHHLEARA-----THKW---NEFVQRNY 2221
            |.::....|....|...|     |.:|..  |.|..::|.....|     ..||   :|.....|
Mouse   280 AGKQKPHCRGMAPNGLPNYIMAPVWKCLHLTKDLREQHHSFWEFAEWIPVAWKWQLLSELEAAPY 344

  Fly  2222 ----EAGALFTQLVPSYSKIPEKNTDGMLPPKNTPSMRYSYGKVKNEDDWKQLAPFEGFNKEGEY 2282
                |...||:   .....|||   ||.:...|    |:| ....:.:.|             :.
Mouse   345 LPQEEKSPLFS---VQREGIPE---DGTIYRIN----RFS-SITAHPERW-------------DV 385

  Fly  2283 VGYLGSSIKKLEWVPLPP-KAASQYLLCSVRSKMKTFARHKKLKDEDGLLMLLKCTAKNAGKSWT 2346
            ..:.|..:..|:|.|:|. .|||||:.......|.......:|....|||.|           |.
Mouse   386 SFFTGGPLWALDWCPVPEGSAASQYVALFSSPDMNETHPLSQLHSGPGLLQL-----------WG 439

  Fly  2347 L-----------RPELHYCVHVPNGPIHSFSFLPSGGYDKSSN--------RLGVLAVANSLSSV 2392
            |           |....|.:...:|.|....|.|||.::....        |||:||:|.|...|
Mouse   440 LGTLQQESCPGNRAHFVYGIACDSGCIWDLKFCPSGAWEHPETLRKAPLLPRLGLLALACSDGKV 504

  Fly  2393 HIYALP---LELANDEIDENADEKVVIQLDSLITL---TLDINNPVQ-DQCTKICWSLSAGHSFL 2450
            .:::||   ..||....|  |.:..:.::..|.||   ::..::|.: .||..:.|..:..|..|
Mouse   505 LLFSLPHPEALLAQQPPD--AMKPAIYKVQCLATLQVGSVQASDPSECGQCLSLAWMPTRPHHHL 567

  Fly  2451 ATGYSSGHFALWDIGEKDNL---------------NCFIRNNQ-----------THFVPVNFLYI 2489
            |.||.:|....|::.....|               .||:.::|           :||:    :..
Mouse   568 AAGYYNGMVVFWNLPTNSPLQRIRLSDGSLKLYPFQCFLAHDQAVRTIQWCKANSHFL----VSA 628

  Fly  2490 G-ERNVQYMDLH--YD--NNGPRWLAVGTSIRQFKIYDIANWSNPY---ILTQDTISSLYMANLT 2546
            | :|.:::.||.  |:  |...|:|:...|           |..||   .:.||...:.|     
Mouse   629 GSDRKIKFWDLRRPYEPINCIKRFLSTELS-----------WLLPYNGVTVAQDNCYASY----- 677

  Fly  2547 WSPICEALVVSSSHF-FRTIAVSP--------SGIQFEHRTLDGTLTTTREMHTNCQQNHMVFVT 2602
              .:|....:.:.:. |:....:|        ||..:......|.:                   
Mouse   678 --GLCGIHYIDAGYLGFKAYFTAPRKGTVWSLSGSDWLGTVAAGDI------------------- 721

  Fly  2603 DNGDLVFLDVRNLNCGPALLKSTVNSR-AVSTTELHHLGSSAPSATDPIDPDEFVRDYGLQINPL 2666
             :|:|:...:.::...|..:|.....| .:...:|      .|....|.|     :||. ..:..
Mouse   722 -SGELIAAILPDMASNPINVKKPAERRFPIYKADL------IPYQDSPED-----QDYS-STSSE 773

  Fly  2667 VPEPHKRKS--------------TYLSA-----KRRPQ------NIHS------LAMTRFNCVRC 2700
            .|.|.|.::              |.||:     :|.|.      ..||      |.:...:.||.
Mouse   774 TPNPPKARTYTETINHHYLLFQDTDLSSFHNLLRREPMLRMQEGEGHSQLCLDRLQLEAIHKVRF 838

  Fly  2701 NWNSPTHTWVAMGAEHGMLRI 2721
            :.|..::.|:..|.:.|::||
Mouse   839 SPNLDSYGWLVSGGQSGLVRI 859

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42588NP_648604.2 PHA03247 <11..541 CDD:223021
WD40 repeat 2363..2403 CDD:293791 16/51 (31%)
WD40 repeat 2437..2477 CDD:293791 11/55 (20%)
WD40 repeat 2484..2533 CDD:293791 12/57 (21%)
WD40 repeat 2541..2588 CDD:293791 7/56 (13%)
Gtf3c2NP_082177.2 HMG17 166..>243 CDD:197773 17/84 (20%)
WD 1 461..517 17/56 (30%)
WD 2 548..589 11/41 (27%)
WD40 <554..>719 CDD:225201 34/187 (18%)
WD40 repeat 554..591 CDD:293791 9/37 (24%)
WD40 <555..640 CDD:295369 18/89 (20%)
WD 3 607..647 8/44 (18%)
WD40 repeat 612..652 CDD:293791 9/44 (20%)
WD 4 828..870 9/33 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_293D8
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0007023
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR15052
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R9435
TreeFam 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.