DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG42588 and Gtf3c2

Sequence 1:NP_648604.2 Gene:CG42588 FlyBaseID:FBgn0260965 Length:2730 Species:Drosophila melanogaster
Sequence 2:NP_001020291.1 Gene:Gtf3c2 RGDID:1560392 Length:951 Species:Rattus norvegicus

Alignment Length:1061 Identity:208/1062 (20%)
Similarity:347/1062 (33%) Gaps:331/1062 (31%)


  Fly  1797 ASEDPEAVEGDSVE------VPIKRKASTRRGSVPRDTPISSVNASDESAVLESV--PK----KG 1849
            ||.:..:||. |:|      :|....:|.:|...|....::.:...|.|:.:..|  |:    .|
  Rat    38 ASSETSSVEA-SIEMSLPPPLPGFEDSSDKRRLPPDQESLTRLEQQDLSSEMAKVSNPRASKPSG 101

  Fly  1850 RRSNISSVPADTTIPKSSKSDSLNAIEIIPPICEE--PKVVPSKRGRKRAAPSD-IETGLAKKLK 1911
            ||.  ...|.....|:..|..|   ..::|.:.::  |...|..:.|.:.:..| :...|:|.|.
  Rat   102 RRG--GRTPRGAKRPQQRKPPS---APLVPGLLDQSNPLSTPMPKKRSQKSKGDLLLLKLSKGLD 161

  Fly  1912 TEESSETERVVDFNLRLLLIRKRDQLDTDEVLTNDGKGQGPLQCGLCLVRSDKNNWQRHIGEHYG 1976
            ..||...:            |..:..:|.       .|:.|.:....:|......|.|       
  Rat   162 QPESPHPK------------RPPEDFETP-------SGERPRRRAAQVVSLPNPGWPR------- 200

  Fly  1977 VGWLVGETPKNITRSGIMTMMKNYLQKNGGKLTCRLCNHQLGSYLGMMLHLEGCGNKQRFQCEFC 2041
                ..:.|.:.:|                                 :|.|:.|.........|.
  Rat   201 ----TCDPPNSASR---------------------------------VLGLQACATTPGSPSHFS 228

  Fly  2042 QRSYTKLSLPVHIRTCPKRIAPQVTEDPEDADGDCKETVFSNAGRAKRKSTIKAETKLKKIGEAL 2106
            |.|...|   ::::...:.::   |..|....|             .:...:.:.||.||     
  Rat   229 QTSPRAL---LYLQELAEELS---TALPAPLSG-------------PKSPKVSSPTKPKK----- 269

  Fly  2107 TTQKSGEGASAKNDFDGDSSDYDLTKDKESSEEYDSEGVDSNEDSISSEGEGSLGDNFSTSKQSK 2171
            |.|.:.:|     :.||.:.|.|.....|..:|.:||....|    ||:.|.....  ||.:...
  Rat   270 TRQAASQG-----EEDGRARDEDFVLQVEGEDEEESEAPSEN----SSDPEPVAPR--STPRGPA 323

  Fly  2172 ANRRGDIDRKRICNRPVN-----VGECQQ--KPLLSRYHHLEARA-----THKW---NEFVQRNY 2221
            |.::....|....|...|     |.:|..  |.|..:.|.....|     ..||   :|.....|
  Rat   324 AGKQKPHCRGMAPNGLPNYIMAPVWKCLHLTKDLREQQHSFWEFAEWIPVAWKWQLLSELEAAPY 388

  Fly  2222 ----EAGALFTQLVPSYSKIPEKNTDGMLPPKNTPSMRYSYGKVKNEDDWKQLAPFEGFNKEGEY 2282
                |...||:   .....|||   ||.:...|    |:| ....:.:.|             :.
  Rat   389 LPQEEKSPLFS---VQREGIPE---DGTIYRIN----RFS-SITAHPERW-------------DV 429

  Fly  2283 VGYLGSSIKKLEWVPLPP-KAASQYLLCSVRSKMKTFARHKKLKDEDGLLMLLKCTAKNAGKSWT 2346
            ..:.|..:..|:|.|:|. .|||||:.......|.......:|....|||.|           |.
  Rat   430 SFFTGGPLWALDWCPVPEGSAASQYVALFSSPDMNETHPLSQLHSGPGLLQL-----------WG 483

  Fly  2347 L-----------RPELHYCVHVPNGPIHSFSFLPSGGYDKSSN--------RLGVLAVANSLSSV 2392
            |           |....|.:...:|.|....|.|||.::....        |||:||:|.|...|
  Rat   484 LGTLQQESCPGNRAHFVYGIACDSGCIWDLKFCPSGAWEHPETLRKAPLLPRLGLLALACSDGKV 548

  Fly  2393 HIYALP---LELANDEIDENADEKVVIQLDSLITL---TLDINNPVQ-DQCTKICWSLSAGHSFL 2450
            .:::||   ..||....|  |.:..:.::..|.||   ::..::|.: .||..:.|..:..|..|
  Rat   549 LLFSLPHPEALLAQQPPD--AMKPAIYKVQCLATLQVGSVQASDPSECGQCLSLAWMPTRPHHHL 611

  Fly  2451 ATGYSSGHFALWDIGEKDNL---------------NCFIRNNQ-----------THFVPVNFLYI 2489
            |.||.:|....|::.....|               .||:.::|           :||:    :..
  Rat   612 AAGYYNGMVVFWNLPTNSPLQRIRLSDGSLKLYPFQCFLAHDQAVRTIQWCKANSHFL----VSA 672

  Fly  2490 G-ERNVQYMDLH--YD--NNGPRWLAVGTSIRQFKIYDIANWSNPY---ILTQDTISSLYMANLT 2546
            | :|.:::.||.  |:  |...|:|:...|           |..||   .:.||...:.|     
  Rat   673 GSDRKIKFWDLRRPYEPINCIKRFLSTELS-----------WLLPYNGVTVAQDNCYASY----- 721

  Fly  2547 WSPICEALVVSSSHF-FRTIAVSP--------SGIQFEHRTLDGTLTTTREMHTNCQQNHMVFVT 2602
              .:|....:.:.:. |:....:|        ||..:......|.:                   
  Rat   722 --GLCGIHYIDAGYLGFKAYFTAPRKGTVWSLSGSDWLGTVAAGDI------------------- 765

  Fly  2603 DNGDLVFLDVRNLNCGPALLKSTVNSR-AVSTTELHHLGSSAPSATDPIDPDEFVRDYGLQINPL 2666
             :|:|:...:.::...|..:|.....| .:...:|      .|....|.|     :||. ..:..
  Rat   766 -SGELIAAILPDMASNPINVKKPAERRFPIYKADL------IPYQDSPED-----QDYS-STSSE 817

  Fly  2667 VPEPHKRKS--------------TYLSA-----KRRPQ------NIHS------LAMTRFNCVRC 2700
            .|.|.|.::              |.||:     :|.|.      ..||      |.:...:.||.
  Rat   818 TPNPPKARTYTETINHHYLLFQDTDLSSFHNLLRREPMLRMQEGEGHSQLCLDRLQLEAIHKVRF 882

  Fly  2701 NWNSPTHTWVAMGAEHGMLRI 2721
            :.|..::.|:..|.:.|::||
  Rat   883 SPNLDSYGWLVSGGQSGLVRI 903

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42588NP_648604.2 PHA03247 <11..541 CDD:223021
WD40 repeat 2363..2403 CDD:293791 16/51 (31%)
WD40 repeat 2437..2477 CDD:293791 11/55 (20%)
WD40 repeat 2484..2533 CDD:293791 12/57 (21%)
WD40 repeat 2541..2588 CDD:293791 7/56 (13%)
Gtf3c2NP_001020291.1 Relaxase <166..284 CDD:304452 28/210 (13%)
WD40 <598..>763 CDD:225201 34/187 (18%)
WD40 repeat 598..635 CDD:293791 9/37 (24%)
WD40 <599..684 CDD:295369 18/89 (20%)
WD40 repeat 656..696 CDD:293791 9/44 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0007023
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR15052
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.