DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG42588 and Son

Sequence 1:NP_648604.2 Gene:CG42588 FlyBaseID:FBgn0260965 Length:2730 Species:Drosophila melanogaster
Sequence 2:XP_006248126.1 Gene:Son RGDID:1309013 Length:2479 Species:Rattus norvegicus

Alignment Length:2617 Identity:487/2618 (19%)
Similarity:841/2618 (32%) Gaps:846/2618 (32%)


  Fly    20 SNQPKPGNPTSAPPPHATKTAAA----PPKRIIKKIQ------LDFN-----KLKEAGLDRQLAE 69
            :|.|..||       .|..|||:    |.:.|::||:      ||..     .||||....:...
  Rat    37 TNAPIEGN-------QAGDTAASARSLPNEEIVQKIEEVLSGVLDTELRYKPDLKEASRKSRCVS 94

  Fly    70 V---------LRKQKLDAKRVDAPSSTSLSTSAAAQSTPTAPESKLQSPQQ-------------- 111
            |         .:|.|...|..:.............:..|...||||:|...              
  Rat    95 VQTDPTDEVPTKKSKKHKKHKNKKKKKKKEKEKKYKRQPEESESKLKSHHDGNVDLESDSFLKFD 159

  Fly   112 ------QLRQPAPQPLVKRFMISEHIEKIVPIQPTPNPTDGDRSKQVKALLKNRILNKSLITNTQ 170
                  .|..|     |:.|.:||..|..:.::|.                         :.:.:
  Rat   160 SEPSALALEHP-----VRAFGLSEASETPLVLEPP-------------------------VVSME 194

  Fly   171 AQQ-------KPTTSKAA------------PKMPPPVCHETA-------------PRSGGI--SP 201
            .|:       ||.|..||            |:.|.||..|.:             |.|..:  ||
  Rat   195 VQEPHALETLKPATKPAALSAVSTSVISEQPEQPVPVMLEPSMTKILDSFAAAPVPMSTAVLRSP 259

  Fly   202 APAAS-SMSIAKADLTVRQKQPPLL-------LNLVNQLPKHRAMCVSSDSPL-VNPHGTVHQVS 257
            .|..: |:...|:.|...:..||.:       |.:...|.....:.:.|::|. |:|     :.|
  Rat   260 EPVVTMSVEYQKSVLKSLETVPPEISKTTLVELPIAKVLEPSETLTIVSETPTEVHP-----EPS 319

  Fly   258 PSPQRIPVQQTTNVFSQPYPPPEVP--IARAAPTVP-----------TQLHRS--------PTPP 301
            ||....|...||:|...|..|.|.|  ||.::.|.|           .:|..|        |.||
  Rat   320 PSTMDFPESSTTDVQRLPEQPVEAPPEIADSSMTRPQESLELPKTTAVELQESSVASALELPGPP 384

  Fly   302 ---LIVLEHKVLAPNEKI----------DLSG--------------------------------- 320
               ::.|:...:.|..::          :|||                                 
  Rat   385 ATSMLELQGPPVTPVPELPGPSATTPVPELSGPLSTLVPELPGPPGTVVPELPGPSVTPVPQLSQ 449

  Fly   321 -LRLPNAPVEATNSPDSAATPNIQSKVIKGKVIMNANKFKVSREKLAEMAKEIRNQ---ADQVKQ 381
             |..|:||......|.....|.:.::.:.|...::| ..:::.:....:|.|:..|   ..:.:|
  Rat   450 ELPGPSAPSMGLEPPQEVPEPPVMAQEVSGVPTVSA-AIELTGQPAVTVAMELTEQPVTTTEFEQ 513

  Fly   382 PQAMKTLNSKDVISTMDTHFTINT----ILQPKRTSPFSSPTLKGNIAPLYNPKPNKATDFSAGS 442
            |.||.|:....       |..:.|    :.||:.......|.         .|....|.:.|...
  Rat   514 PVAMTTVEHPG-------HPEVTTATGLLGQPEAAMVLELPG---------QPVATTALELSGQP 562

  Fly   443 SIRSNP----LPVESTKQTIIESNESTEDKAIDFPTSVPTTPGNRYSSEPNQATSNSVELELVSN 503
            |:...|    ||  |..:.:..|.:|....|::.|..:..|....:|.:...|.:    |||:..
  Rat   563 SVTGVPELSGLP--SATRALELSGQSVATGALELPGQLMATGALEFSGQSGAAGA----LELLGQ 621

  Fly   504 LETEGVMAVANPIDFPVYIPSTPDP------------TTESSPLKSFNEPINYPEVNALGS---- 552
            ....||:.:......| .:|..|..            ||......:.::.:..|...||.|    
  Rat   622 PLATGVLELPGQPGAP-ELPGQPVATVALEISVQSVVTTSELSTMTVSQSLEVPSTTALESYNTV 685

  Fly   553 ----------STPVYI---PITSERGHLTAEVTTESNLVDLPEPENIPKDMNADLVQSVPLISKL 604
                      .|.|.:   |:.::..|:.|..|.|::::       ....|::.::.|..:.|::
  Rat   686 AQELPTTLVGETSVTVGVDPLMAQESHMLASNTMETHML-------ASNTMDSQMLASNTMDSQM 743

  Fly   605 NREPNTEIGDMHSQADTSAVSQEQSSSSAATSPEHKIQSAVDFIAQLTAENPLDESSFMDLSPEE 669
             ...||    |.||...|:....|..:|:....:....|::|  :|:.|.:.:|.......|.:.
  Rat   744 -LASNT----MDSQMLASSTMDSQILASSTMDSQMLATSSMD--SQMLASSSMDSQMLATSSMDS 801

  Fly   670 QRLSALFGFGGCSFASSSVTQPEEEELPIGKIVKMDDMNILHATLD---ISSDSTNVLRISPNAV 731
            |.|           |:||                ||...:..:::|   :::.|.:...::.:::
  Rat   802 QML-----------ATSS----------------MDSQMLATSSMDSQMLATSSMDSQMLATSSM 839

  Fly   732 KMQSSVTS------LSTPLVDLQVGDSALEDTNIHNNFPNPVDNTTAS---ELQNVKSSVTETSI 787
            ..|...||      |:|..:|.|:..|...|:.:           .||   :.|.:.|...:..:
  Rat   840 DSQMLATSSMDSQMLATSSMDSQMLASGAMDSQM-----------LASGTMDAQMLASGTMDAQM 893

  Fly   788 QEANDETTVITTLPKKCDEKSQVPLEEVKTASDP--------------------------EPLKE 826
            ..::.:.:.:  :..|..:..::..:..:.|.||                          :|.:.
  Rat   894 LASSTQDSAM--MGSKSPDPYRLAQDPYRLAQDPYRLGHDPYRLGHDAYRLGQDPYRLGHDPYRL 956

  Fly   827 VNPPVKRAP----IRSKKAKI-----NLVQR----TKRPSIQKPIEVKKAKLDFEEEDEQAMAID 878
            ...|.:.:|    |..:..:|     .|..|    ..|.|:......:::.:...|  ...|:.:
  Rat   957 TPDPYRMSPRPYRIAPRSYRIAPRPYRLAPRPLMLASRRSMMMSYAAERSMMSSYE--RSMMSYE 1019

  Fly   879 HSLME---DRYGVPGIEVNDNSA---STSSDQINHNLSSVKNNPKVPADEKQCEEEISPVQDE-- 935
            .|:|.   :|..:...|.:..||   |..|.....::.|......:.|.|:..   :||:.|.  
  Rat  1020 RSMMSPMAERSMMSAYERSMMSAYERSMMSPMAERSMMSAYERSMMSAYERSM---MSPMADRSM 1081

  Fly   936 -----DSAKSQAHEDKDDESEISYQKEDKIQSKSSSERDL----------------TQLY----- 974
                 |.:...::...|.....||...|:....|.::|.:                |:.|     
  Rat  1082 MSMGADRSMMSSYSAADRSMMSSYSAADRSMMSSYTDRSMMSMAADSYTDSYTDSYTEAYMVPPL 1146

  Fly   975 ---HPPKMP--KNKSTHKTSSQEDFEVPQPASSSSNVSLI----------------DVLSQNPPA 1018
               .||.||  ..:....|......|.|:.|:.|:..|.:                .|....||.
  Rat  1147 PPEEPPTMPPLPPEEPPMTPPLPPEEPPEGAALSTEQSALTADNTWSTEVTLPTEESVSQPEPPV 1211

  Fly  1019 PQGEPQ----LPFRKDSQELNTSVDSSVDAKGIQNLIGHLTAEKVV----PQTKKLSPTSKTEEA 1075
            .|.|..    :|....:.|..||:               |.:|.|:    |..:..|..:.|...
  Rat  1212 SQSEISEPLVVPANYSASESETSM---------------LASEAVMTVPEPAREPESSVTSTPVE 1261

  Fly  1076 SKALPRKKLVKTRPVLSKRSTKVGQKNPSEKPVHFEFLHPVSANAGNRIPTSSTSDDDGSIFLGF 1140
            |..:...::|..||:....|.......||          .:::.|.....||.|.|         
  Rat  1262 SAVVAEHEMVPERPMTYMVSETTMAAEPS----------VLTSEASVMAETSETYD--------- 1307

  Fly  1141 DDNEGKRSKTPVRSQRVKQMKINETDISDDATPDYDETEEEQPSIEIQQPVKNS---------AA 1196
                         |.|.....|:|..:|           ..:|::.|.||.::|         |.
  Rat  1308 -------------SMRPSGHAISEVSMS-----------LLEPAVTISQPAESSLELPSMAVPAP 1348

  Fly  1197 DSKFTFDRHQVVGAFSDDSDSSD-----------AGPSSPMDFGD-----------NMSIEDSRT 1239
            .:..|.:....|...:..:||..           |.|..|:....           ::||.:|..
  Rat  1349 STIATTESLVAVPELAAVADSEPPIMAVPEPPTVAVPEPPVTTAPEPPPMITPELCSLSISESPV 1413

  Fly  1240 S----------EEDVTAWAKLVNENEKPFVDEVLSPSKSGTEATV----DCSRIDDPLKTDGE-- 1288
            :          |..|||.:.:  .:.:|.| .||.||.|..:..:    .|..|.:|.....|  
  Rat  1414 AVSELPALADPEHAVTAVSGV--SSLEPSV-PVLEPSVSVLQPVMIVSEPCVSIQEPTVAVSEPA 1475

  Fly  1289 ATSSHHSEITPFCASSESKCVTDEKQPVIKEKDSITLDRKSEKSRRMSTKSILMTTDEHVKDSST 1353
            ...|.|::||       |..:..|..||:.|...::    |:..:.|:    |::.||::     
  Rat  1476 VIVSEHTQIT-------SPEMAVESSPVMVESSVVS----SQIMKGMN----LLSGDENL----- 1520

  Fly  1354 TSKINEKRLTSSPLKTPGSSENTELRLLE---EGNASDKQNEHLISPEALTNQKNAKLKKNLEEV 1415
            .|::..:.....|.:.|....:.:..|.|   :.|.....|.|||:.||..:...|.....:.|.
  Rat  1521 GSEVGTQETLLHPGEEPHDGGHLKSDLYEHEYDRNTDLTVNSHLIAKEAEHSTACAAAIVPVGET 1585

  Fly  1416 SPEK--PVSSLRSR--------------GKRKSGSHNKKLD--------ESEKHSENISCAK--K 1454
            |.||  |:|..:..              |:..|.....:||        |....|..||.:|  .
  Rat  1586 SEEKILPISETKEMIELDTCPAVSEADVGRSLSSQLALELDTVGTSKGFEFVAASAPISESKYDV 1650

  Fly  1455 EEKATERDLEDGEQLTTVDSTEDTDSTRNPID----NITAENTAIRAKRKTRCIVSKDSKKEM-- 1513
            |...|.:|.|....::|..|.........|:.    ::...:|.:..|.....:..|:|.:.:  
  Rat  1651 EVSVTTQDTEHDMVISTSPSGGSEADIEGPLPAKDIHLDLPSTNLVCKDVEDSLPIKESDETVTV 1715

  Fly  1514 ----KDLKED--GVKSSKDDLPPTMDSSEKPEDQKLDDVPDVSVKSKGTRKSLRASLNNEVPAIQ 1572
                |:..||  |...:|:.:|.:..|....|..:.|.|..:..|......||||.:  |.|.:.
  Rat  1716 ALSPKESSEDTEGPLPNKEIVPDSGYSVSIDEINEADLVRPLLPKDMERLTSLRAGI--EGPLLP 1778

  Fly  1573 PE---------PVINTV--SSSENSTSKMED--VVTEPNDT-----KNK---------------- 1603
            .|         ||:.::  .:||:|:.:.:|  :..:..||     |||                
  Rat  1779 SEVERDKSVASPVVISIPERASESSSEEKDDYEIFVKVKDTHEKSKKNKNRDKGEKEKKRDSSLR 1843

  Fly  1604 -RHTRNKSPQIKGSPTIKHFESIESEAIKGSDVS----SKAESSIRPTRQRQSRYSKAKSEPKAL 1663
             |..|:||.:.|..   |......|.|.|.|..|    |:..|..|..|:|:|..|::||..:. 
  Rat  1844 SRSKRSKSSEHKSR---KRTSESRSRARKRSSKSKSHRSQTRSRSRSRRRRRSSRSRSKSRGRR- 1904

  Fly  1664 ADSKSENVSDPSISTVTQDLGQAKYDSSEKPSGDVQLNPVKDSCNEQDACKDSNQAKDLPKSRKK 1728
            :.||.:....|...:.:::..:.:..|.:.          :.:...:............|..|::
  Rat  1905 SVSKEKRKRSPKHRSKSRERKRKRSSSRDN----------RKTVRARSRTPSRRSRSHTPSRRRR 1959

  Fly  1729 RQSQSGTSKIIVPPVSQPKPEKLHEQNRDESVRAPKEQLDPTTSKNSR----------GKRQSRS 1783
            .:|........:.|..:.:......:......|.|..: ..|.|:.||          .:|:|||
  Rat  1960 SRSVGRRRSFSISPSRRSRTPSRRSRTPSRRSRTPSRR-SRTPSRRSRTPSRRSRTPSRRRRSRS 2023

  Fly  1784 IA-------------ATNTPTTMLTTASEDPEAVEGDSVEVPIKRK--ASTRRGSVPRD------ 1827
            :.             .:.||.....:.|             ||:||  .|:.||..|:.      
  Rat  2024 VVRRRSFSISPVRLRRSRTPLRRRFSRS-------------PIRRKRSRSSERGRSPKRLTDLDK 2075

  Fly  1828 ---TPISSVNASDESA-----------------VLESVPKKGRRSNI------------SSVPAD 1860
               ..|:..||:...|                 :.|.|.||...:.|            |....|
  Rat  2076 AQLLEIAKANAAAMCAKAGVPLPPNLKPAPPPTIEEKVAKKSGGATIEELTEKCKQIAQSKEDDD 2140

  Fly  1861 TTIPKSSKSD-----------------------SLN--AIEIIPP-----ICEEPKVVPSKRGRK 1895
            ..:.|...||                       :||  |.:..||     :.:|..|....:.||
  Rat  2141 VIVNKPHVSDEEEEEPPFYHHPFKLSEPKPIFFNLNIAAAKPTPPKSQVTLTKEFPVSSGSQHRK 2205

  Fly  1896 RAA-------------------------------PSDIETGLAKKLKTEESSETERVVDFNLRLL 1929
            :.|                               |.||.|.::::...::.. :|...|.....:
  Rat  2206 KEADSVYGEWVPVEKNGEESKDDDNVFSSSLPSEPVDISTAMSERALAQKRL-SENAFDLEAMSM 2269

  Fly  1930 LIRKRDQLD---------------------TDEVLTNDG------KGQ----GPLQCGLCLVRSD 1963
            |.|.::::|                     |.|.|.|.|      |.|    .|:..|:..|...
  Rat  2270 LNRAQERIDAWAQLNSIPGQFTGSTGVQVLTQEQLANTGAQAWIKKDQFLRAAPVTGGMGAVLMR 2334

  Fly  1964 KNNWQRHIGEHYGVGWLVGETPKNI----TRSGIMTMMKNYLQKNGGKLTCRLCN----HQLGSY 2020
            |..|:.  ||..|......:.|..:    .|.|::.:.:. .||..|..:..:.:    |.:.:.
  Rat  2335 KMGWRE--GEGLGKNKEGNKEPILVDFKTDRKGLVAVGER-AQKRSGNFSAAMKDLSGKHPVSAL 2396

  Fly  2021 LGMMLHLEGCGNKQRFQ 2037
                  :|.| ||:|:|
  Rat  2397 ------MEIC-NKRRWQ 2406

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42588NP_648604.2 PHA03247 <11..541 CDD:223021 134/699 (19%)
WD40 repeat 2363..2403 CDD:293791
WD40 repeat 2437..2477 CDD:293791
WD40 repeat 2484..2533 CDD:293791
WD40 repeat 2541..2588 CDD:293791
SonXP_006248126.1 Forkhead_N 1014..1140 CDD:254796 23/129 (18%)
G-patch 2325..2368 CDD:279867 10/45 (22%)
DSRM 2392..2460 CDD:214634 6/23 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.