DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG42588 and GTF3C2

Sequence 1:NP_648604.2 Gene:CG42588 FlyBaseID:FBgn0260965 Length:2730 Species:Drosophila melanogaster
Sequence 2:XP_005264329.1 Gene:GTF3C2 HGNCID:4665 Length:950 Species:Homo sapiens

Alignment Length:1199 Identity:232/1200 (19%)
Similarity:376/1200 (31%) Gaps:443/1200 (37%)


  Fly  1655 KAKSEPKALADSKSENVSDPSISTVTQDLGQAKYDSSEK-PSGDVQL--NPVKDSCNEQDACKDS 1716
            |:..:.|.||.|:..:...|....:....|.......|. |.|::.:  :|.::..|:.|.    
Human    15 KSLLKHKVLAPSRIADSGQPFWGVLMDTCGVGYVALGEAGPVGNMTVVDSPGQEVLNQLDV---- 75

  Fly  1717 NQAKDLPKSRKKRQSQSGTSKIIVPPVSQPKPEKLHEQNRDESVRAPKEQLDPTTSKNSRGKRQS 1781
                        :.|...||......:|.|.|....|.:.|:. |.|.||               
Human    76 ------------KTSSEMTSAEASVEMSLPTPLPGFEDSPDQR-RLPPEQ--------------- 112

  Fly  1782 RSIAATNTP--TTMLTTASEDPEAVEGDSVEVPIKRKASTRRGSVPRDTPISSVNASDESAVLES 1844
            .|::....|  ::.::..|:...:..|.      ||...||:|                      
Human   113 ESLSRLEQPDLSSEMSKVSKPRASKPGR------KRGGRTRKG---------------------- 149

  Fly  1845 VPKKGRRSNISSVPADTTIPKSSKSDSLNAIEIIPPICEEPK----VVPSKRGRKRAAPSDIETG 1905
             ||:.::.|..|.|                  ::|.:.::..    .:|.|||||..|       
Human   150 -PKRPQQPNPPSAP------------------LVPGLLDQSNPLSTPMPKKRGRKSKA------- 188

  Fly  1906 LAKKLKTEESSETERVVDFNLRLLLIRKRDQLDTDEVLTNDGKGQGPLQCGLCLVRSDKNNWQRH 1970
                                 .|||::....||..|       .|.|        :....:::..
Human   189 ---------------------ELLLLKLSKDLDRPE-------SQSP--------KRPPEDFETP 217

  Fly  1971 IGEHYGVGWLVGETPKNITRSGIMTMMKNYLQKNGGKLTCRLCNHQLGSYLGMMLHLEGCGNKQR 2035
            .||.          |:.  |:..:.::  |||                                 
Human   218 SGER----------PRR--RAAQVALL--YLQ--------------------------------- 235

  Fly  2036 FQCEFCQRSYTKLSLPVHIRTCPKRIAPQVTEDPEDADGDCKETVFSNAGRAKRKSTIKAETKLK 2100
               |..:...|.|..||   :||        |.|:                      :.:.||.|
Human   236 ---ELAEELSTALPAPV---SCP--------EGPK----------------------VSSPTKPK 264

  Fly  2101 KIGEALTTQKSGEGASAKNDFDGDSSDYDLTKDKESSEEYDSEGVDSNEDSISSEGEGSLGDNF- 2164
            ||.:.... ..||      :.||...|.|.....|:.:..:|||...:    |||.|..:..:. 
Human   265 KIRQPAAC-PGGE------EVDGAPRDEDFFLQVEAEDVEESEGPSES----SSEPEPVVPRSTP 318

  Fly  2165 --STSKQSKANRRGDIDRKRICNRPVNVGEC--------QQK----------PLLSRYH---HLE 2206
              |||.:.|.:.||........:....|.:|        :||          ||..::|   .||
Human   319 RGSTSGKQKPHCRGMAPNGLPNHIMAPVWKCLHLTKDFREQKHSYWEFAEWIPLAWKWHLLSELE 383

  Fly  2207 ARATHKWNEFVQRNYEAGALFTQLVPSYSKIPEKNTDGMLPPKNTPSMRYSYGKVKNEDDWKQLA 2271
            | |.:...|      |...||:   .....:||   ||.|...|    |:| ....:.:.|    
Human   384 A-APYLPQE------EKSPLFS---VQREGLPE---DGTLYRIN----RFS-SITAHPERW---- 426

  Fly  2272 PFEGFNKEGEYVGYLGSSIKKLEWVPLPPKA-ASQYLLCSVRSKMKTFARHKKLKDEDGLLMLLK 2335
                     :...:.|..:..|:|.|:|..| ||||:.......|.......:|....|||.|  
Human   427 ---------DVSFFTGGPLWALDWCPVPEGAGASQYVALFSSPDMNETHPLSQLHSGPGLLQL-- 480

  Fly  2336 CTAKNAGKSWTL-----------RPELHYCVHVPNGPIHSFSFLPSGGYDKSSN--------RLG 2381
                     |.|           |....|.:...||.|....|.|||.::....        |||
Human   481 ---------WGLGTLQQESCPGNRAHFVYGIACDNGCIWDLKFCPSGAWELPGTPRKAPLLPRLG 536

  Fly  2382 VLAVANSLSSVHIYALP---LELANDEIDENADEKVVIQLDSLITL---TLDINNPVQ-DQCTKI 2439
            :||:|.|...|.:::||   ..||....|  |.:..:.::..:.||   ::...:|.: .||..:
Human   537 LLALACSDGKVLLFSLPHPEALLAQQPPD--AVKPAIYKVQCVATLQVGSMQATDPSECGQCLSL 599

  Fly  2440 CWSLSAGHSFLATGYSSGHFALWDIGEKDNL---------------NCFIRNNQ----------- 2478
            .|..:..|..||.||.:|....|::.....|               .||:.::|           
Human   600 AWMPTRPHQHLAAGYYNGMVVFWNLPTNSPLQRIRLSDGSLKLYPFQCFLAHDQAVRTLQWCKAN 664

  Fly  2479 THFVPVNFLYIG-ERNVQYMDLHYDNNGPRWLAVGTSIRQFKIYDIANWSNPY---ILTQDTISS 2539
            :||:    :..| :|.:::.||.      |......||::|...::| |..||   .:.||...:
Human   665 SHFL----VSAGSDRKIKFWDLR------RPYEPINSIKRFLSTELA-WLLPYNGVTVAQDNCYA 718

  Fly  2540 LYMANLTWSPICEALVVSSSHF-FRTIAVSP--------SGIQFEHRTLDGTLTTTREMHTNCQQ 2595
            .|       .:|....:.:.:. |:....:|        ||..:......|.:            
Human   719 SY-------GLCGIHYIDAGYLGFKAYFTAPRKGTVWSLSGSDWLGTIAAGDI------------ 764

  Fly  2596 NHMVFVTDNGDLVFLDVRNLNCGPALLKSTVNSR-AVSTTELHHLGSSAPSATDPIDPDEFVRDY 2659
                    :|:|:...:.::...|..:|..|..| .:...:|      .|....|..||......
Human   765 --------SGELIAAILPDMALNPINVKRPVERRFPIYKADL------IPYQDSPEGPDHSSASS 815

  Fly  2660 GLQINPLVPEPHKRKSTYLSA--------------------KRRPQ------NIHS------LAM 2692
            |      ||.|.|.: ||...                    :|.|.      ..||      |.:
Human   816 G------VPNPPKAR-TYTETVNHHYLLFQDTDLGSFHDLLRREPMLRMQEGEGHSQLCLDRLQL 873

  Fly  2693 TRFNCVRCNWNSPTHTWVAMGAEHGMLRI 2721
            ...:.||.:.|..::.|:..|.:.|::||
Human   874 EAIHKVRFSPNLDSYGWLVSGGQSGLVRI 902

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42588NP_648604.2 PHA03247 <11..541 CDD:223021
WD40 repeat 2363..2403 CDD:293791 16/51 (31%)
WD40 repeat 2437..2477 CDD:293791 11/55 (20%)
WD40 repeat 2484..2533 CDD:293791 12/53 (23%)
WD40 repeat 2541..2588 CDD:293791 7/56 (13%)
GTF3C2XP_005264329.1 WD40 repeat 509..582 CDD:293791 21/75 (28%)
WD40 <597..>762 CDD:225201 34/183 (19%)
WD40 repeat 597..634 CDD:293791 9/37 (24%)
WD40 <598..683 CDD:295369 18/89 (20%)
WD40 repeat 655..695 CDD:293791 9/50 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_293D8
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0007023
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR15052
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.