DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG42588 and sfc6

Sequence 1:NP_648604.2 Gene:CG42588 FlyBaseID:FBgn0260965 Length:2730 Species:Drosophila melanogaster
Sequence 2:NP_595930.1 Gene:sfc6 PomBaseID:SPBC21H7.05 Length:582 Species:Schizosaccharomyces pombe

Alignment Length:705 Identity:137/706 (19%)
Similarity:234/706 (33%) Gaps:241/706 (34%)


  Fly  2115 ASAKNDFDGDSSDYDLTKDKESSEEYDSEGVDSNEDSI-------------------SSEGEGS- 2159
            :|.|||.|.|.....:.::..|.|:.:.|....|...:                   ||:|.|: 
pombe    12 SSYKNDEDNDDDGDFVLENVMSEEDIEIETPSRNRKRVSTTRRTPSKPIRSQPLTPSSSKGAGNE 76

  Fly  2160 -LGDNFSTSKQS--KANRRGDIDRKRICNRPVNVGECQQKPLLSRYHHLEARATHKWNEFVQ--R 2219
             ...|.||::.|  |.:.:|                .::|.:.|...|:|  :.:|....::  :
pombe    77 PKSQNSSTTRGSAKKQSSKG----------------LEEKLINSYGTHVE--SLNKGRRLIEIWK 123

  Fly  2220 NYEAG---ALFTQLVPSYSKIPE-KNTDG--MLPPKNTP---------SMRYSYGKVKNEDDWKQ 2269
            .||..   :.|.....|.||:.. .|.||  :|.....|         |:.:.:...:..:..:.
pombe   124 YYETAPGQSSFEGQTSSDSKLQTLLNLDGQQLLSYSENPFYLFEVKNLSISFHFESPQQVEPCQP 188

  Fly  2270 LAPFEGFNKEGEYVGYLGSSIKKLEWVPLPPKAASQYLLCSVRSK---------MKTFARHKKLK 2325
            :.||:...::..:|...|..:..:.|  ||....:|:|......|         |:|..|::   
pombe   189 VNPFKENPQKSGFVVNTGIPLSSVSW--LPTNKETQFLAVGGMLKFSETTESVFMRTSGRNQ--- 248

  Fly  2326 DEDGLLMLLKCTAKNAGKS-------WTLRPELHYC--VHVPNGPIHSFSFLPSGGYDKSSNRLG 2381
                 :.|.|...|...||       |....:|.:|  :.|.:..:...:.:.|.|      :|.
pombe   249 -----IQLWKLENKTNFKSEFILYHDWGSVLQLEWCPTISVEDSILGFLAVVCSDG------KLR 302

  Fly  2382 VLAVANSLSSVHIYALPLELANDEIDENADEKVVIQLDSLITLTLDINNPVQDQCTKICWSLSAG 2446
            ||.|..|....|::.           |.||            .|...|:.:...||.:.......
pombe   303 VLRVPRSPVKFHVFV-----------EQAD------------FTFGFNDSLISCCTWVSPEHGDI 344

  Fly  2447 HSFLATGYSSGHFALWDIGEKDNLNCFIRNNQTHFVPVNFLYIGERNVQYMDLHYDNNGPRWLAV 2511
            |..| .|.|:|:.|||||........|       ::|.:..|| ...||.:|     :.| ||.:
pombe   345 HQIL-VGCSNGYLALWDILSSQECPLF-------YIPYHDSYI-HNVVQCLD-----DFP-WLFL 394

  Fly  2512 GTSI----RQFKIYDIANWSNPYILTQDTISSLYMANLTWSPICEALVVSSSHFFRTIAVSPSGI 2572
            .|:.    |.|.|.|....:.|....:|...:     :||:.:.::::..|..  :::.:     
pombe   395 TTAFDCYTRIFDIRDPIIDNRPLSHKRDICYT-----ITWNNMLQSIISCSES--QSVVI----- 447

  Fly  2573 QFEHRTLDGTLTTTREMHTNCQQNHMVFVTDNGDLVFLDVRNLNCGPALLKSTVNSRAVSTTELH 2637
                .:|.||.|.                       .||.||   |..:        ::|.::.|
pombe   448 ----ESLRGTSTQ-----------------------LLDERN---GSII--------SLSNSKFH 474

  Fly  2638 HLGSSAPSATDPIDPDEFVRDYGLQINP--LVPEPHKRKSTYLSAKRRPQNIHSLAMTRF----- 2695
            ...:.|.|       |..|    ..:||  |:...||:|:          |:|.:....:     
pombe   475 PFVACAAS-------DGIV----TIVNPFRLLGFSHKQKA----------NVHRIFQLEYSEKQD 518

  Fly  2696 -----------------------------NCVRCNWNSPTHTWVAMGAEHGMLRI 2721
                                         |.|..|.|.....|:|.|...|:||:
pombe   519 SYRMLDGFRPRLPKAKKLDMYIYPWQIQVNKVEWNGNKGYAGWLASGMACGILRV 573

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42588NP_648604.2 PHA03247 <11..541 CDD:223021
WD40 repeat 2363..2403 CDD:293791 8/40 (20%)
WD40 repeat 2437..2477 CDD:293791 12/40 (30%)
WD40 repeat 2484..2533 CDD:293791 14/53 (26%)
WD40 repeat 2541..2588 CDD:293791 7/47 (15%)
sfc6NP_595930.1 DUF4048 <34..>95 CDD:289997 12/61 (20%)
WD40 42..500 CDD:225201 114/591 (19%)
WD40 <243..445 CDD:295369 56/261 (21%)
WD40 repeat 274..326 CDD:293791 15/81 (19%)
WD40 repeat 331..373 CDD:293791 13/50 (26%)
WD40 repeat 381..417 CDD:293791 12/42 (29%)
WD40 repeat 424..457 CDD:293791 7/72 (10%)
WD40 repeat 465..499 CDD:293791 9/53 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR15052
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.