DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG42588 and gtf3c2

Sequence 1:NP_648604.2 Gene:CG42588 FlyBaseID:FBgn0260965 Length:2730 Species:Drosophila melanogaster
Sequence 2:XP_002943430.2 Gene:gtf3c2 XenbaseID:XB-GENE-997570 Length:1021 Species:Xenopus tropicalis

Alignment Length:1124 Identity:226/1125 (20%)
Similarity:373/1125 (33%) Gaps:371/1125 (33%)


  Fly  1767 LDPTTS--------------------KNSRGKRQSRSIAATNTPTTMLT-TASEDP-----EAVE 1805
            |.||||                    ::||.:|  |.:...:.|.:..| ||:|..     |..:
 Frog    53 LPPTTSDDVTSGLRQQHFLFNGGADEQSSRARR--RPVRLMDPPASGTTETAAEGTMVLRVEESD 115

  Fly  1806 GDSVEVPIKRKASTRRGSVPRD----TPI-------------------SSVNASDESAVLESVPK 1847
            |.:..||:...|.:.....|.:    ||:                   ::::.||....:...|.
 Frog   116 GQAHAVPVAPGARSPGKQEPVNYLGHTPVKCCMVGSTGNTGAPPGDCRNNLSLSDSPVCVREEPS 180

  Fly  1848 ---------KGRRSN--ISS--VPADTTIPKSSKSDSLNAIEIIPPICEE--PKV-VPSKRGRKR 1896
                     :.:|.|  :||  :||....|.|.....|:  |..||...:  |.| ||.|||||.
 Frog   181 TQASLGCSAQAKRLNDPLSSPALPASVPEPMSPTLPCLH--ENGPPTGSQLTPLVKVPKKRGRKS 243

  Fly  1897 AAPSDIETGLAKKLKTEESSETERVVDFNLRLLLIRKRDQLDTDEVLTNDGKGQGPLQCGLCLVR 1961
            .|                            .|||||:...||.:.:....           ..:|
 Frog   244 KA----------------------------ELLLIRQAQALDAEALARQS-----------LALR 269

  Fly  1962 SDKNNWQRHIGEHYGVGWLVGETPKNITRSGIMTMMKNYLQKNGGKLTCRLCNHQLGSYLGMMLH 2026
            .:.:|..            :..||....|.........||             |.|...|     
 Frog   270 QESDNQD------------METTPSGRPRRRAAKTALMYL-------------HDLADEL----- 304

  Fly  2027 LEGCGNKQRFQCEFCQRSYTKLSLPVHIRTCPKRIAPQVTEDPEDADGDCKETVFSNAGRAKRKS 2091
                             |.:.||.|    |.|..:          :||...|     .|:::|: 
 Frog   305 -----------------SSSGLSSP----TKPSAV----------SDGSSDE-----RGKSRRR- 332

  Fly  2092 TIKAETKLKKIGEALTTQKSGEGASAKNDFDGDSSDYDLTKDKESSEEYDSEGVDSNEDSISSEG 2156
                             ::..||:.       :.|||.:::|.....|::.|    :.:|:|...
 Frog   333 -----------------KRKAEGSE-------EDSDYVVSEDVLKEAEFEEE----DNESLSGAY 369

  Fly  2157 EGSLG----DNFST-SKQSKANRRGDIDRKRICNRPVNVGECQQKPLLSRYHHLEARATHKWNEF 2216
            |..|.    ..||| .::|....||..|..  .:..:.|      |:....|     .|.::.:.
 Frog   370 EPELSTFRRKAFSTPGERSGPQIRGFADNG--FHNSIMV------PVWKASH-----VTAEYRDT 421

  Fly  2217 VQRNYEAGALFTQLVPS---YSKIPEKNTDGMLPPKN-TPSMRYSYGKVKNEDDWKQLAPFEGF- 2276
            ...::|    |...:||   :..:..:..:..||.:. :|........:|.|.....|..|:.. 
 Frog   422 CYSDWE----FPDWIPSTENWHFLTHREAEPYLPAQRLSPPFTIRREGIKEEAKPCTLGRFQSLP 482

  Fly  2277 --NKEGEYVGYLGSSIKKLEWVP-LPPKAASQYLLCSVRSKMKTFARHKKLKDEDG------LLM 2332
              .:..:...::|..:..|||.| |....:.|||.......|..  |||    .||      ||.
 Frog   483 PHPQRWDMNFFVGGPVWSLEWCPTLGGSGSCQYLALYCHWGMDD--RHK----VDGVHPGPALLQ 541

  Fly  2333 LLKCTAKNAGKSWTLRPELHYCVHVPNGPIHSFSFLPSGGYD------KSSN--RLGVLAVANSL 2389
            |......:...|....|...|.:.|.:|.|....|.||||::      ||..  |||:||.|.|.
 Frog   542 LWSLGPLDMENSCDSGPVFSYGIAVDHGCIWDMKFCPSGGWELPCTSRKSLQMARLGLLAAAFSS 606

  Fly  2390 SSVHIYALP-----LELANDEID-ENADEKVVIQLDSLITL---TLDINNPVQD-QCTKICWSLS 2444
            ..:.||:||     ......::. ::..|..|.::|.::.|   ::....|.:. ||..:.|..:
 Frog   607 GHIEIYSLPHPESLYSHRKSQVKAQDLWEHTVCKVDCVVRLQVGSIKACTPGESGQCFTLAWHPA 671

  Fly  2445 AGHSFLATGYSSGHFALWDIGEKDNLNCFIRNNQTHFVP----VNFLYIGE--RNVQYMDLHYDN 2503
            ..|.:||.|:..|..::||:..|..|.   |..|...:.    ::||....  |:|::...  |.
 Frog   672 KPHQYLAAGFYDGTVSIWDLKTKSVLQ---RVRQGRVIKQYPFLSFLSHDHAVRSVEWCKA--DG 731

  Fly  2504 NGPRWLAVGTSIRQFKIYDI-----------------ANWSNPY---ILTQDTISSLYMANLTWS 2548
            |   :|....:.|:.|.:|:                 .:|..||   .:.||   :.|.::    
 Frog   732 N---FLVTSGNDRRLKFWDLRRLPEPINNMKRFQSTELSWLLPYSGVAVAQD---NCYASH---- 786

  Fly  2549 PICEALVVSSSHF-FRTIAVSP--------SGIQFEHRTLDGTLTTTREMHTNCQQNHMVFVTDN 2604
            .:|....|.|... ::...|:|        ||..:......|.:|                    
 Frog   787 GLCGIHYVDSGFLGYKPYFVTPRKGTVWSVSGSDWLSSIAAGDVT-------------------- 831

  Fly  2605 GDLVFLDVRNLNCGPALLKSTVNS-----RAVSTTELHHLGSSAPSATDP--------------- 2649
            |:::.:.:.|||.      ::||:     |.....:...|...:|.:|.|               
 Frog   832 GEVIVIVLPNLNV------TSVNTKRPADRRFPVYKADFLPHVSPESTQPGTELPAGPLAESSEW 890

  Fly  2650 --IDPDEF---VRDYGLQINPLVPEPHKR-------KSTYLSAKRRPQNIHSLAMTRFNCVRCNW 2702
              :.|..|   ...:||....:.....||       |..:.:..:...|:..:.:...:.||.:.
 Frog   891 GHLKPKSFRAAAGRFGLLFQDMDMRDFKRLLSREPVKRMHANENKGDLNMERVQIEAVHKVRFSP 955

  Fly  2703 NSPTHTWVAMGAEHGMLRI 2721
            |..||.|||.|...|::||
 Frog   956 NLDTHAWVASGGHSGLVRI 974

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42588NP_648604.2 PHA03247 <11..541 CDD:223021
WD40 repeat 2363..2403 CDD:293791 18/53 (34%)
WD40 repeat 2437..2477 CDD:293791 11/40 (28%)
WD40 repeat 2484..2533 CDD:293791 13/71 (18%)
WD40 repeat 2541..2588 CDD:293791 10/56 (18%)
gtf3c2XP_002943430.2 WD40 <564..768 CDD:225201 50/212 (24%)
WD40 repeat 572..623 CDD:293791 18/51 (35%)
WD40 <637..>749 CDD:295369 28/120 (23%)
WD40 repeat 664..715 CDD:293791 13/54 (24%)
WD40 repeat 721..754 CDD:293791 8/38 (21%)
WD40 repeat 766..806 CDD:293791 9/47 (19%)
WD40 repeat 814..844 CDD:293791 8/50 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_293D8
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0007023
OrthoInspector 1 1.000 T1060943
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.