DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sap130 and SAP130

Sequence 1:NP_729834.1 Gene:Sap130 FlyBaseID:FBgn0262714 Length:1294 Species:Drosophila melanogaster
Sequence 2:NP_001139400.1 Gene:SAP130 HGNCID:29813 Length:1083 Species:Homo sapiens

Alignment Length:1395 Identity:301/1396 (22%)
Similarity:502/1396 (36%) Gaps:422/1396 (30%)


  Fly     4 PSEGGAGGGPVGGGSTATAPSAPLKTIKIRTQQLHTHAVPSLSLLPSIYPSSSSSSLAATGSLSA 68
            |..|....|..|||...        .:::.:||......||..|      |.:.|.:|.:|    
Human     7 PQAGEIEAGGAGGGRRL--------QVEMSSQQFPRLGAPSTGL------SQAPSQIANSG---- 53

  Fly    69 SASLVSHSHPPLQLRGVINKYSLPSHLPSSAA---------------HPAVAAKITHVKSDGGGG 118
            ||.|::.:.......|..::.|...|:.||::               :|.|....||        
Human    54 SAGLINPAATVNDESGRDSEVSAREHMSSSSSLQSREEKQEPVVVRPYPQVQMLSTH-------- 110

  Fly   119 ISIAGTPILSGGTIKVASANQVQQTSLGGTPIALNAGQATTAASIRAIGAGGQSTQVRVVMPMIK 183
                         ..||||          ||:|:.|..|....::....:.|          ::|
Human   111 -------------HAVASA----------TPVAVTAPPAHLTPAVPLSFSEG----------LMK 142

  Fly   184 QLENVTATGRTQITAIPAA---PARSGANASITVTRPVTQATYLPRASVTATQMGGVGVGVGQRL 245
            .....|...|....|.|:.   |.:.....::|:...:.||:.:|.|:::..|  |....:...:
Human   143 PPPKPTMPSRPIAPAPPSTLSLPPKVPGQVTVTMESSIPQASAIPVATISGQQ--GHPSNLHHIM 205

  Fly   246 VTPLRATSSATVTPTAPTVLSSTGGFVRGATAS--VSRSGVALTSQPSSAVISSSNSGAWMQSQG 308
            .|.::.:...:..|..|..:.:: ...|||.|:  :|.|.|....:|:|.:.:::.      :|.
Human   206 TTNVQMSIIRSNAPGPPLHIGAS-HLPRGAAAAAVMSSSKVTTVLRPTSQLPNAAT------AQP 263

  Fly   309 QVQLIRTIHQPRQR--------------IITTSAGVSNASVVTTTPVQA-PTALSVSAGQPLATQ 358
            .||.|  ||||.|.              :.|.||..:.:.|:|||...| .:|||    :|..:.
Human   264 AVQHI--IHQPIQSRPPVTTSNAIPPAVVATVSATRAQSPVITTTAAHATDSALS----RPTLSI 322

  Fly   359 QATGPGGGPQAYVATVLPQRQHQATLVYSSNVSAPN--ASQNPGQQFNPRFAVATPTGGVTTTTP 421
            |..     |.|.::...|.:....|    :.::.|:  |...|.||.:        |....|...
Human   323 QHP-----PSAAISIQRPAQSRDVT----TRITLPSHPALGTPKQQLH--------TMAQKTIFS 370

  Fly   422 GGTTVTPRQVRPIPLGKSFPTAKLNTTSISIRAPSIPQLNTSVTASPTAVSVSGGATVAPGRGPG 486
            .||.|....|.||....:.|:|   ||:.|:          |.|.:||:..|:   ...|.....
Human   371 TGTPVAAATVAPILATNTIPSA---TTAGSV----------SHTQAPTSTIVT---MTVPSHSSH 419

  Fly   487 AGGTALTATNLPTTRIIQLQQPATGTTQQIIG------------SGARLAGNVMLQPFLMSTTAA 539
            |  ||:|.:|:|..:::  .|..|.|:.:|..            ||.|.:.|    |..|.|   
Human   420 A--TAVTTSNIPVAKVV--PQQITHTSPRIQPDYPAERSSLIPISGHRASPN----PVAMET--- 473

  Fly   540 AKMGIRPPVTMTAK-----VQPS---LTITQLNPIGKLSAGGGSGGQTMGPQGVASIQAVPVPNV 596
             :...||.|.:..:     ..||   |......||               ...|::|:..|   |
Human   474 -RSDNRPSVPVQFQYFLPTYPPSAYPLAAHTYTPI---------------TSSVSTIRQYP---V 519

  Fly   597 SASVVNSSSVTGATSAAGGATV---------------------LPLTISGRGAGVGPGGNILTGT 640
            ||...| |::|..|.....:||                     .|..||.:|....|.|   |..
Human   520 SAQAPN-SAITAQTGVGVASTVHLNPMQLMTVDASHARHIQGIQPAPISTQGIQPAPIG---TPG 580

  Fly   641 LTP-------IKNASGITLGKMMMAP-ASSAPGADGSSTS-----GATVTGFQRTWNPVVASQSQ 692
            :.|       |.:|:.|....:..|| .:..|..:|.:::     |||:..     ||:      
Human   581 IQPAPLGTQGIHSATPINTQGLQPAPMGTQQPQPEGKTSAVVLADGATIVA-----NPI------ 634

  Fly   693 LMKIDEKGSAATIYYESMPASASTGVLSLTTTTVTQSTQAQAQLVSSAGGSLSVSSLPFASHATA 757
                            |.|.||:.     ..|||.|:....|...:.|.||....|:.....|| 
Human   635 ----------------SNPFSAAP-----AATTVVQTHSQSASTNAPAQGSSPRPSILRKKPAT- 677

  Fly   758 GAGSGGGGSQATFTVLPSGAGGTATRTIGHQQLIIPAGPNSAPPQHMVIPLHTSVKVTTGAGNPQ 822
                                .|.|.|    :.||.|..|:.|.|:     :.:|::.|:|:..| 
Human   678 --------------------DGMAVR----KTLIPPQPPDVASPR-----VESSMRSTSGSPRP- 712

  Fly   823 QATASGALVSSFMRKRDAEGSPIRAAKNLGPTLLSMASNNSGQNMPPAPGTTFNIQPVSVTVPQS 887
                :||...|.:.                   :|||:                  ||:|     
Human   713 ----AGAKPKSEIH-------------------VSMAT------------------PVTV----- 731

  Fly   888 VGSGLTVEALAKKERERVTHGVASSAASVPATVGPVNSTRNSRADSPASSDGSTTVSANSSPG-- 950
                 ::|.::.:..::.|..|..:|...|.|: |......|....||       |:.::.||  
Human   732 -----SMETVSNQNNDQPTIAVPPTAQQPPPTI-PTMIAAASPPSQPA-------VALSTIPGAV 783

  Fly   951 -VDQQLQDRIGDQPATGGAGGRDNSTHFNPINEMYSSHQSIQQNLGHSSLGARSGSSAFVDVQAP 1014
             :...:.......|.:...||..:|....|:.|:     .:::.:..            :|:..|
Human   784 PITPPITTIAAAPPPSVTVGGSLSSVLGPPVPEI-----KVKEEVEP------------MDIMRP 831

  Fly  1015 TPQQQQPQQVPHLVGSTQMQQGTRMNGTGNSSSSSYD----CSSRKKPRRSTNDSQHSTQSQASL 1075
            .      ..||.|..:|.......:  ..|.|..:.|    .|.|||||:    .||...::...
Human   832 V------SAVPPLATNTVSPSLALL--ANNLSMPTSDLPPGASPRKKPRK----QQHVISTEEGD 884

  Fly  1076 SLPPPSSEPTPPAGASYMQKHNNGGLLVTAATPGVAPNSAPGDANHRNSTPAVAGNKENANPVDF 1140
            .:...|::.......|.:.|                       |..|.|.|....::|.   |.:
Human   885 MMETNSTDDEKSTAKSLLVK-----------------------AEKRKSPPKEYIDEEG---VRY 923

  Fly  1141 VIRRPR-NCALLNTYKPTHKLANNHFHRYTDVKPREERRATVIDLANQPNVQGKINGWKIYHLRS 1204
            |..||| ...||..|:...|.|.:||.||:||:.:||::|.:.::|||..|..:..|||::...:
Human   924 VPVRPRPPITLLRHYRNPWKAAYHHFQRYSDVRVKEEKKAMLQEIANQKGVSCRAQGWKVHLCAA 988

  Fly  1205 QMEDLNESEVFSLGRLETMLQDL--EKDKEKHSEIERVTELLKGNIQRSKIITDGINEAQNQLMK 1267
            |:..|...|.....||..:.:.:  :|......::.|:.||::||:||.|::.|.|:||::.::|
Human   989 QLLQLTNLEHDVYERLTNLQEGIIPKKKAATDDDLHRINELIQGNMQRCKLVMDQISEARDSMLK 1053

  Fly  1268 IFEHKPHVSNIITRCASKR---NFKKREKI 1294
            :.:||..|..::.:..:.:   ..|::||:
Human  1054 VLDHKDRVLKLLNKNGTVKKVSKLKRKEKV 1083

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sap130NP_729834.1 SAP130_C <1138..1275 CDD:292633 47/140 (34%)
SAP130NP_001139400.1 Atrophin-1 <45..365 CDD:331285 82/397 (21%)
DNA_pol3_gamma3 <276..683 CDD:331207 115/531 (22%)
SAP130_C 661..1066 CDD:318271 120/550 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C345815704
eggNOG 1 0.900 E1_2CMF4
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 112 1.000 Inparanoid score I4792
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006132
OrthoInspector 1 1.000 T1073257
orthoMCL 1 0.900 OOG5_135313
Panther 1 1.100 LDO PTHR13497
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5197
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
109.870

Return to query results.
Submit another query.