DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sap130 and sap130b

Sequence 1:NP_729834.1 Gene:Sap130 FlyBaseID:FBgn0262714 Length:1294 Species:Drosophila melanogaster
Sequence 2:NP_001243552.1 Gene:sap130b ZFINID:ZDB-GENE-070912-570 Length:1043 Species:Danio rerio

Alignment Length:1383 Identity:304/1384 (22%)
Similarity:488/1384 (35%) Gaps:448/1384 (32%)


  Fly     4 PSEGGAGGGPVGGGSTATAPSAPLKTIKIRTQQLHTHAVPSLSLLPSIYPSSSSSSLAATGSLSA 68
            ||  |.|.|...|.:||..|.:...|    ..:...||           |....||.|.......
Zfish    12 PS--GLGQGQTAGNNTAGFPGSQKST----GHEDSNHA-----------PRELMSSGATVFRDDK 59

  Fly    69 SASLVSHSHPPLQLRGVINKYS------LPSHLPSSAAHPAVAAKITHVKSDGGGGISIAGTPIL 127
            ..::|...:|..|::...:..:      ||.|||....  :|:|..:|:..    |:|:|.|.  
Zfish    60 QETVVVRPYPQPQMQPPSHGAAPTLPPPLPQHLPIQPV--SVSAAPSHLPQ----GLSLAFTE-- 116

  Fly   128 SGGTIKVASANQVQQTSLGGTPIALNAGQATTAASIRAIGAGGQSTQVRVVMPMIKQLENVTATG 192
              |::|                .||.|..::                 ||:.|       .....
Zfish   117 --GSLK----------------SALKAPMSS-----------------RVIAP-------APVPT 139

  Fly   193 RTQITAIPAAPARSGANASITVTRPVTQATYLPRASVTATQ--MGGVGVGVGQRLVTPLRATSS- 254
            .:.:|..|..|..      :|.|...|||:.:|.|:::..|  .|.:     ..|:|.::...| 
Zfish   140 PSHLTLPPKVPGH------LTATMESTQASGIPVATISGQQGHSGNL-----HHLMTSVQIIRSG 193

  Fly   255 -------ATVTP------------TAPTVLSSTGGFVRGATASVSRSGVALTSQPSSAVISSSNS 300
                   ::..|            .|..|:||:    :|||      |:...:.||||.      
Zfish   194 APVQQIGSSAAPQHCFPSHLPRGAAAAAVMSSS----KGAT------GLRPAAGPSSAT------ 242

  Fly   301 GAWMQSQGQVQLIRTIHQPRQR--IITTSAGVSNASV--VTTTPVQAPTALSVSA--GQPLATQQ 359
                   ||..:...||||.|.  |:|||..|....|  ||.|..|:|...:|:|  |..:..:.
Zfish   243 -------GQPTVQHIIHQPIQSRPIVTTSTAVLPTVVAPVTATRPQSPVITTVAAHSGDMVHGRS 300

  Fly   360 ATG--PGGGPQAYVATVLPQRQH----QATLVYSSNVSAPNASQNPGQQFNPRFAVATPTGGVTT 418
            |..  |   |||.::...|....    :.||.....::|..|..:...| .|.|:..||.     
Zfish   301 AVAIHP---PQATLSIQRPPPSRDTPTRITLPSHPAIAAQKALSHSVAQ-KPIFSTVTPV----- 356

  Fly   419 TTPGGTTVTPRQVRPIPLGKSFPTAKLNTTSISIRAPSIP--QLNTSVTASPTAVSVSGGATVAP 481
               ...||.|.||             .||........|.|  |::.|...:.|..|.|..|    
Zfish   357 ---AAATVAPIQV-------------TNTAPSPTTTGSTPHTQISNSNIVTMTVASHSSHA---- 401

  Fly   482 GRGPGAGGTALTATNLPTTRIIQLQQPATGTTQQIIG-----------SGARLAGN--------- 526
                    ||:|.:.:|..:::  .||.|.|:.:|..           ||.|.:.|         
Zfish   402 --------TAVTTSTIPVAKVV--PQPITHTSPRIQSEYTERGNLIPISGHRSSPNPITMENRTD 456

  Fly   527 ------VMLQPFLMSTTAAAKMGIRPPVTMTAKVQP-SLTITQLNPIGKLSAGGGSGGQTMGPQG 584
                  |..|.||.:..:|       |..:|....| :.:::.:.|....:....:...|....|
Zfish   457 NRQSVPVQFQYFLPTYQSA-------PYPLTHTYTPITSSVSSIRPYPVTAQAPSAAMPTQAGVG 514

  Fly   585 VA------SIQAVPVPNVSASVVNSSSV-TGATSAAGGATVLPLTISGRGAGVGPGGNILTGTLT 642
            ||      |:|.:.|..::.  :|:.:: .||.:|.|   :.|..|        |..|:.|    
Zfish   515 VASAVHLNSMQLMTVDRITQ--INTQNIQPGAMTAQG---IQPTPI--------PAQNLHT---- 562

  Fly   643 PIKNASGITLGKMMMAPASSAPGADGSSTSGATVTGFQRTWNPVVASQSQLMKIDEKGSAATIYY 707
                ::.||...:..:|.:.......|..|            .|:|..|.||    ..|.:..:.
Zfish   563 ----SAQITTPSIQPSPVNQQQPPTESKAS------------VVLADGSTLM----ANSISNAFS 607

  Fly   708 ESMPASASTGVLSLTTTTVTQSTQAQAQLVSSAGGSLSVSSLPFASHATAGAGSGGGGSQATFTV 772
            .|.|           |||:     ||..:.::..|:.|:.:.|..|.......:.|...:.  .:
Zfish   608 NSQP-----------TTTL-----AQTHIQNANTGTPSLVTSPRPSILRKKPANEGAAVRK--NL 654

  Fly   773 LPSGAGGTATRTI--------GHQQLIIPAGPNSAPPQHMVIPLHTSVKVTTGAGNPQQATASGA 829
            :|:..|.|....|        |..:   |||....|..||.:.             |..|.|..|
Zfish   655 IPAQLGDTTAPRIDGPIRSASGSPR---PAGVKPKPDIHMSLA-------------PSVAAAIEA 703

  Fly   830 LVSSFMRKRDAEGSPIRAAKNLGPTLLSMASNNSGQNMPPAPGTTFNIQPVSVTVPQSVGSGLTV 894
            :.|        :|:. :.|:::||....:||.       |.|....::.|.|:..|         
Zfish   704 IPS--------QGTE-QQAQHVGPPSSQLASQ-------PLPSLLASVTPPSLPAP--------- 743

  Fly   895 EALAKKERERVTHGVASSAASVPATV-GPVNSTRNSRAD--SPASSDGSTTVSANSSPGVDQQLQ 956
                           |.||.....|| .|:.|..|..|.  .||:::.|.....::.|.::    
Zfish   744 ---------------ALSALPAAMTVTQPIPSMTNVVAQPIQPAANNTSVCTINSNLPELN---- 789

  Fly   957 DRIGDQPATGGAGGRDNSTHFNPINEMYSSHQSIQQNLGHSSLGARSGSSAFVDVQAPTPQQQQP 1021
              |..:|..     .|:|   .|:                 :||..||:              |.
Zfish   790 --IKQEPEP-----MDSS---KPV-----------------ALGPNSGA--------------QM 813

  Fly  1022 QQVPHLVGSTQMQQGTRMNGTGNSSSSSYDCSSRKKPRRSTNDSQH--STQSQASLSLPPPSSEP 1084
            ..||    .|.:..|               .|.|||||:    .||  ||:....:.......|.
Zfish   814 LTVP----PTDLTLG---------------ASPRKKPRK----QQHIISTEESEMMETNSTDEEK 855

  Fly  1085 TPPAGASYMQKHNNGGLLVTAATPGVAPNSAPGDANHRNSTPAVAGNKENANPVDFVIRRPRNCA 1149
            .||...|..                         |..|.|.|....::|....|...:|.|  ..
Zfish   856 FPPKPLSQR-------------------------AEKRKSPPKEYIDEEGVRYVPARVRPP--IT 893

  Fly  1150 LLNTYKPTHKLANNHFHRYTDVKPREERRATVIDLANQPNVQGKINGWKIYHLRSQMEDLN--ES 1212
            ||..|:...|.|.:||.||:||:.:|:::.::.|:|||..|..:..||||:...:|:..|:  |.
Zfish   894 LLRHYRNPWKAAYHHFQRYSDVRIKEDKKGSMQDVANQKGVVCRAQGWKIHLCAAQLMQLSNLEH 958

  Fly  1213 EVFSLGRLETMLQDLEKDKEKHSEIE--RVTELLKGNIQRSKIITDGINEAQNQLMKIFEHKPHV 1275
            :|:|  ||.|:.:.....|:..::::  |:.||::||:||.|::.|.|.||::.::|:.:||..|
Zfish   959 DVYS--RLTTLQEGFVPKKKAGADVDLHRINELIQGNMQRCKLVMDQITEARDSMLKVLDHKERV 1021

  Fly  1276 SNIITRCASKRNFKKREK 1293
            ..::.:.:|.:...|.::
Zfish  1022 LKLLNKNSSTKKLNKLKR 1039

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sap130NP_729834.1 SAP130_C <1138..1275 CDD:292633 48/141 (34%)
sap130bNP_001243552.1 SAP130_C 629..1026 CDD:292633 126/552 (23%)
Cupredoxin <907..943 CDD:302766 15/36 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C345816877
eggNOG 1 0.900 E1_2CMF4
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006132
OrthoInspector 1 1.000 T596959
orthoMCL 1 0.900 OOG5_135313
Panther 1 1.100 O PTHR13497
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5197
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
98.820

Return to query results.
Submit another query.