DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sap130 and Sap130

Sequence 1:NP_729834.1 Gene:Sap130 FlyBaseID:FBgn0262714 Length:1294 Species:Drosophila melanogaster
Sequence 2:XP_006526012.1 Gene:Sap130 MGIID:1919782 Length:1077 Species:Mus musculus

Alignment Length:1391 Identity:295/1392 (21%)
Similarity:482/1392 (35%) Gaps:446/1392 (32%)


  Fly     1 MSAPSEGGAGGGPVG------------------GGSTATAPSAPLKTIKIRTQQLHTHAVPSLSL 47
            :|.|....|..|..|                  |......||:.|...:.:.:.:.....|.:.:
Mouse    36 LSQPPSQIASSGSAGLINQVATVNDEAGRDADVGTREHVGPSSSLPPREEKQEPVVVRPYPQVQM 100

  Fly    48 LPSIYPSSSSSSLAATG---------SLSASASLVSHSHPPLQLRGVINKYSLPSHLPSSAAHPA 103
            ||:.:..:|::.:|.|.         .||.|..|:.   ||       .|.::||. |.:.|.| 
Mouse   101 LPAHHAVASATPVAVTAPPAHLTPAVPLSFSEGLMK---PP-------PKPTMPSR-PIAPAPP- 153

  Fly   104 VAAKITHVKSDGGGGISIAGTPILSGGTIKVASANQVQQTSLGGTPIALNAGQATTAASIRAIGA 168
                            |....|....|.:.|...:.:.|.|  ..|:|..:||....:::..|  
Mouse   154 ----------------STMSLPPKVPGQVTVTMESSIPQAS--AIPVATISGQQGHPSNLHHI-- 198

  Fly   169 GGQSTQVRVVMPMIKQLENVTA----TGRTQITAIPAAPARSGANASITVTRPVTQATYLPRASV 229
              .:|.|:  |.:|:  .|...    .|.:.:....||.|...::...||.||.:|   ||.|  
Mouse   199 --MTTNVQ--MSIIR--SNAPGPPLHIGASHLPRGAAAAAVMSSSKVTTVLRPTSQ---LPNA-- 252

  Fly   230 TATQMGGVGVGVGQRLVTPLRATSSATVTPTAPTVLSSTGG--------FVRGATASVSRSGVAL 286
             ||....|...:.|.:.:....|:|:|:.|.....:|:|..        ....|.:::||..:::
Mouse   253 -ATAQPAVQHLIHQPIQSRPPVTTSSTIPPAVVATVSATRAQSPVITTTAAHAADSTLSRPTLSI 316

  Fly   287 TSQPSSAVISSSNSGAWMQSQGQVQLIRT---------IHQPRQRIITTSAGVSNASVVTT-TPV 341
            ...||:|:.        :|...|.:.:.|         :..|:|::.|    ::..::.:| |||
Mouse   317 QHPPSAAIS--------IQRPAQSRDVTTRITLPSHPALGTPKQQLHT----MAQKTIFSTGTPV 369

  Fly   342 QAPTALSVSAGQPLATQQATGPGGGPQAYVATV----LPQRQHQATLVYSSNVSAPNASQNPGQQ 402
            .|.|...:.|...|.:....|.....||..:|:    :|.....||.|.:||:  |.|...|.| 
Mouse   370 AAATVAPILATNTLPSTTTAGSVSHTQAPTSTIVTMTMPSHSSHATAVTTSNI--PVAKVVPQQ- 431

  Fly   403 FNPRFAVATPTGGVTTTTPGGTTVTPRQVRP---------IPLGKSFPTAKLNTTSISIR---AP 455
                         :|.|:|        :::|         ||:  |...|..|..::..|   .|
Mouse   432 -------------ITHTSP--------RIQPDYPPERSSLIPI--SGHRASPNPVAMETRNDNRP 473

  Fly   456 SIP-QLNTSVTASPTAVSVSGGATVAPGRGPGAGGTALTATNLPTT---RIIQLQQPATGTTQQI 516
            |:| |....:...|            |...|.|..|....|:..:|   ..:..|.|.:..|.| 
Mouse   474 SVPVQFQYFLPTYP------------PSAYPLAAHTYTPITSSVSTIRQYPVSAQAPNSTITAQ- 525

  Fly   517 IGSGARLAGNVMLQPFLMSTTAAAK----MGIRPPVTMTAKVQPSLTITQLNPIGKLSAGGGSGG 577
              :|..:|..|.|.|..:.|..|:.    .||:|....|..:||:                    
Mouse   526 --TGVGVASTVHLNPMQLMTVDASHARHIQGIQPAPISTQGIQPA-------------------- 568

  Fly   578 QTMGPQGVASIQAVPVPNVSASVVNSSSVTGATSAAGGATVLPLTISGRGAGVGPGGNILTGTLT 642
                |.|.:.||..|:           ...|..|||                             
Mouse   569 ----PIGTSGIQPAPI-----------GTPGIHSAA----------------------------- 589

  Fly   643 PIKNASGITLGKMMMAPASSAPGADGSSTS-----GATVTGFQRTWNPVVASQSQLMKIDEKGSA 702
            ||.     |.|....|.|:..|..:|.:::     |||:..     ||:                
Mouse   590 PIN-----TQGLQPAAMANQQPQPEGKTSAVVLADGATIVA-----NPI---------------- 628

  Fly   703 ATIYYESMPASASTGVLSLTTTTVTQSTQAQAQLVSSAGGSLSVSSLPFASHATAGAGSGGGGSQ 767
                  |.|.||:.     ..|||.|:....|...:.|.||....|:.....||           
Mouse   629 ------SNPFSAAP-----AATTVVQTHSQSASTNTPAQGSSPRPSILRKKPAT----------- 671

  Fly   768 ATFTVLPSGAGGTATRTIGHQQLIIPAGPNSAPPQHMVIPLHTSVKVTTGAGNPQQATASGALVS 832
                      .|.|.|    :.|:.|..|:.|.|:                            |.
Mouse   672 ----------DGMAVR----KTLLPPQPPDVATPR----------------------------VE 694

  Fly   833 SFMRKRDAEGSPIRAAKNLGPTLLSMASNNSGQNMPPAPGTTFNIQPVSVTVPQSVGSGLTVEAL 897
            |.|  |.|.|||                       .||.....:...||:..|.:|    ::|.:
Mouse   695 SSM--RSASGSP-----------------------RPAGAKPKSEVHVSIATPVTV----SLETI 730

  Fly   898 AKKERERVTHGVASSAASVPATVGPVNSTRNSRADSPASSDGSTTVSANSSPGVDQQLQDRIGDQ 962
            :.:..|:.|..|..:|...|.|:..:.:     |.||.|   ...::.::.||.          .
Mouse   731 SNQNAEQPTVAVPPTAQQPPPTIPSMIA-----AASPPS---QPAIALSTIPGA----------V 777

  Fly   963 PATGGAGGRDNSTHFNPINEMYSSHQSIQQNLGHSSLGARSGSSAFVDVQAPTP-----QQQQPQ 1022
            |.|            .||..:.::          .:|.|..|.:....:..|.|     ::.:|.
Mouse   778 PVT------------PPITTIAAT----------PTLSAPVGGTPSTVLGPPVPEIKVKEEAEPV 820

  Fly  1023 QVPHLVGSTQMQQGTRMNGTGNSSSSSYDCSSRKKPRRSTNDSQHSTQSQAS-LSLPPPSSEP-T 1085
            .:...|.:.                          |..:||....|....|| ||:||....| .
Mouse   821 DITRPVSTV--------------------------PPLATNTVSPSLALLASNLSMPPSDLPPGA 859

  Fly  1086 PPAGASYMQKH----NNGGLLVTAATPG--VAPNSAPGDANHRNSTPAVAGNKENANPVDFVIRR 1144
            .|......|:|    ..|.::.|.:|..  .|..|....|..|.|.|....::|.   |.:|..|
Mouse   860 SPRKKPRKQQHVISTEEGDMMETNSTDDEKSAAKSLLVKAEKRKSPPKEYIDEEG---VRYVPVR 921

  Fly  1145 PR-NCALLNTYKPTHKLANNHFHRYTDVKPREERRATVIDLANQPNVQGKINGWKIYHLRSQMED 1208
            || ...||..|:...|.|.:||.||:||:.:||::|.:.::|||..|..:..|||::...:|:..
Mouse   922 PRPPITLLRHYRNPWKAAYHHFQRYSDVRVKEEKKAMLQEIANQKGVSCRAQGWKVHLCAAQLLQ 986

  Fly  1209 LNESEVFSLGRLETMLQDL--EKDKEKHSEIERVTELLKGNIQRSKIITDGINEAQNQLMKIFEH 1271
            |...|.....||..:.:.:  :|......::.|:.||::||:||.|::.|.|:||::.::|:.:|
Mouse   987 LTNLEHDVYERLTNLQEGIIPKKKAATDDDLHRINELIQGNMQRCKLVMDQISEARDSMLKVLDH 1051

  Fly  1272 KPHVSNIITRCASKR---NFKKREKI 1294
            |..|..::.:..:.:   ..|::||:
Mouse  1052 KDRVLKLLNKNGTVKKVSKLKRKEKV 1077

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sap130NP_729834.1 SAP130_C <1138..1275 CDD:292633 47/140 (34%)
Sap130XP_006526012.1 SAP130_C 655..1060 CDD:292633 73/415 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C345817818
eggNOG 1 0.900 E1_2CMF4
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 114 1.000 Inparanoid score I4795
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006132
OrthoInspector 1 1.000 T1083338
orthoMCL 1 0.900 OOG5_135313
Panther 1 1.100 LDO PTHR13497
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5197
TreeFam 1 0.960
109.870

Return to query results.
Submit another query.