DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sap130 and sap130

Sequence 1:NP_729834.1 Gene:Sap130 FlyBaseID:FBgn0262714 Length:1294 Species:Drosophila melanogaster
Sequence 2:XP_012825454.1 Gene:sap130 XenbaseID:XB-GENE-6083596 Length:1054 Species:Xenopus tropicalis

Alignment Length:1378 Identity:302/1379 (22%)
Similarity:473/1379 (34%) Gaps:433/1379 (31%)


  Fly     1 MSAP--SEGGA--GGGPVGGG-------------STATAPSAPLKTIKIRTQQLHTHAVPSLSLL 48
            ||.|  |..||  |..|.|.|             |.......|.:..|  .:.:.....|.:.:|
 Frog    22 MSIPQVSNSGATMGQNPQGQGDEIIRDMDVQSRDSIGAGTVLPSRDDK--QEPVVVRPYPQVQML 84

  Fly    49 PSIYPSSSSSSLAATGSLSASASLVSHSHPPLQLRGVINKYSLPSHLPSSAAHPAVAAKITHVKS 113
            .|.:|...:.||:.|...:...|.|     ||.....|.|.:..|.:||....||..:       
 Frog    85 ASHHPLQPAPSLSMTAQPAHLTSAV-----PLSFSENILKQTSKSTMPSRPIAPAPPS------- 137

  Fly   114 DGGGGISIAGTPILSGGTIKVASANQVQQTSLGGTPIALNAGQATTAASIRAIGAGGQSTQVRVV 178
                  :::..|.:| |.:.|...:.:.|||  ..|:|..:||.....|:..|.|.     ..|.
 Frog   138 ------ALSAVPKVS-GQVTVTMESGLPQTS--AIPVATISGQQGHPNSLHHIVAA-----TNVQ 188

  Fly   179 MPMIKQLENVTATGRTQITAIPAAPARSGANASITVTRPVTQATYLPRASVTATQMGGVGVGVGQ 243
            |.:|:             ::.|..|...|             |::|||.:..|..|.      ..
 Frog   189 MSIIR-------------SSAPGPPLHIG-------------ASHLPRGAAAAAVMS------SS 221

  Fly   244 RLVTPLRATSSATVTPTAPTVLSSTGGFVRGATASVSRSGVALTSQPSSAVISSSNSGAWMQSQG 308
            ::.|.||..|:.  .|:|....|:|...:.....  ||..|..|:..:.||::            
 Frog   222 KVTTMLRPASAQ--IPSAVAAQSATQHIIHPPIQ--SRPPVTTTTSVTPAVVA------------ 270

  Fly   309 QVQLIRTIHQPRQRIITTSAGVSNASVVTTTPVQA------PTALSVSAGQPLATQQATGPGGGP 367
                            |.||..:.:.|:||||..|      ||         |:.||...|    
 Frog   271 ----------------TVSATRAQSPVITTTPAHAAEPVLRPT---------LSIQQHPPP---- 306

  Fly   368 QAYVATVLPQRQHQATLVYSSNVSAPNASQNP--GQQFNPRFAVATPTGGVTTTTPGGTTVTPRQ 430
                |.:..||..||....::.::.|.   :|  |.|.....|:|..|...|     |..|....
 Frog   307 ----AAISIQRSAQARDAATTRITLPT---HPALGAQKPQLHAMAQKTLFGT-----GNPVAAAT 359

  Fly   431 VRPIPLGKSFPTAKLNTTSISIRAPSIPQLNTSVTASPTAVSVSGGATVA-PGRGPGAGGTALTA 494
            |.||                 :...::|.:.||.:|..|.||.|...|:. |.....|  ||:||
 Frog   360 VAPI-----------------LATNTLPSVTTSGSAPHTQVSTSAIVTMTMPTHSSHA--TAVTA 405

  Fly   495 TNLPTTRIIQLQQPATGTTQQIIGSGARLAGNVMLQPFLMSTTAAAKMGIRP---PVTMTAKVQP 556
            :|:|..:::  .|..|.|:.:|........||::..|           |.|.   |:||.|:.: 
 Frog   406 SNIPVAKVV--PQQITHTSPRIQSEYGTERGNLIPIP-----------GHRASPNPMTMEARSE- 456

  Fly   557 SLTITQLNPIGKLSAGGGSGGQTMGPQGVASIQAVPV------PNVSASVVNSSSVTGATSAAGG 615
                                          :.|.|||      |....|                
 Frog   457 ------------------------------NRQPVPVQLQYFLPTYPPS---------------- 475

  Fly   616 ATVLPLTISGRGAGVGPGGNILTGTLTPIKNASGITLGKMMMAPASSAPGADGSSTSGATVTGFQ 680
              ..||.               ..|.|||                         ::|.:|:..:.
 Frog   476 --AYPLA---------------AHTYTPI-------------------------TSSVSTIRQYP 498

  Fly   681 RTWNPVVASQSQLMKIDEKGSAATIYYESMPASASTGVLSLTTTTVTQSTQAQAQLVSSAGGSLS 745
                  |::|:....|..:..|:|::...|.      ::::.|:........|...||:.|    
 Frog   499 ------VSAQAPNSAITAQSVASTVHLNPMQ------LINMDTSHTRHIQGIQPAPVSAQG---- 547

  Fly   746 VSSLPFASHATAGAGSGGGGSQATFTVLPSGAGGTATRTIGHQQLIIPAGPNSAPPQHMVIPLHT 810
            :...||::.          |.|||    |....|....:|..|                  .:|.
 Frog   548 IQPSPFSAQ----------GIQAT----PINTQGIQQTSINTQ------------------AIHP 580

  Fly   811 SVKVTTGAGNPQQATASGALVSSFMRKRDAEGSPIRAAKNLGPTLLSMASNNSGQNMPPAPGTTF 875
            :..:|    |....|:|   |||.....:.:.|.:.|.   |.|:::...|           :||
 Frog   581 ATSIT----NQGVQTSS---VSSQQAPNEPKASVVLAE---GATIVANPIN-----------STF 624

  Fly   876 NIQPVSVTVPQS------------VGSGLTVEALAKKERERVTHGVASSAASVPATVGPVNSTRN 928
            :..|...||.||            .||......|.||.   .|.|::...:.:|...|...|.|.
 Frog   625 SATPAGTTVMQSHSQSPGISSSPAQGSSPRPSILRKKP---ATDGLSVRKSLIPPHPGDAVSPRQ 686

  Fly   929 SRADSPASSDGSTTVSANSSPGVDQQLQDRIGDQPATGGAGGRDNSTHFNPINEMYSSHQSIQQN 993
               ||...|..::...|.:.|..|..:....|   .||..|..|..   |....:.|||      
 Frog   687 ---DSSLRSTSASPRPAGAKPKADLHVPVAPG---VTGDPGAADQP---NAAASLPSSH------ 736

  Fly   994 LGHSSLGARSGSSAFVDVQAPTPQQQQPQQVPHLVGSTQMQQGTRMNGTGNSSSSSYDCSSRKKP 1058
              |.:....|..|.......|:.....|..:|.|.....:        ..|:.|.:....::.|.
 Frog   737 --HPAAAVPSPPSQPASGPIPSSIHITPATIPALSAPPPL--------LSNAPSGAVIPEAKVKE 791

  Fly  1059 RRSTNDSQHSTQSQASLSLPPPSSEPTPPAGAS--YMQKHNNGGLLVTAATPGVAPNSAP----- 1116
            .....|          :|.|..:..|.||...|  .....||..:......||.:|...|     
 Frog   792 EAEPMD----------ISRPVSAVPPLPPNSISSPLTVLANNISIPAGELLPGASPRKKPRKQQH 846

  Fly  1117 ------GDANHRNST---------PAVAGNKENANP---------VDFVIRRPR-NCALLNTYKP 1156
                  ||....|||         |..:..::..:|         |.:|..||| ...||..|:.
 Frog   847 VISTEEGDMMETNSTDEERCHAVKPLTSRPEKRKSPPKEYIDEEGVRYVPVRPRPPITLLRHYRN 911

  Fly  1157 THKLANNHFHRYTDVKPREERRATVIDLANQPNVQGKINGWKIYHLRSQMEDL--NESEVFSLGR 1219
            ..|.|.:||.||:||:.:||::.|:.::|||..:..::.|||.:...:|:..|  .|.:||.  |
 Frog   912 PWKAAYHHFQRYSDVRVKEEKKLTLQEVANQKGITCRVQGWKTHLCAAQLLQLIKLEQDVFE--R 974

  Fly  1220 LETMLQDLEKDKEK---HSEIERVTELLKGNIQRSKIITDGINEAQNQLMKIFEHKPHVSNIITR 1281
            | |:||:....|:|   ..::.|:.||::||:||.|::.|.|.|:::.::|:.:||..|..::.:
 Frog   975 L-TVLQEGLIPKKKTATDDDLHRINELIQGNMQRCKLVMDQITESRDCMLKVLDHKDRVLKLLNK 1038

  Fly  1282 C-ASKRNFKKREK 1293
            . ||:|..|.::|
 Frog  1039 SGASRRLTKVKQK 1051

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sap130NP_729834.1 SAP130_C <1138..1275 CDD:292633 51/143 (36%)
sap130XP_012825454.1 SAP130_C 648..1037 CDD:292633 108/430 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C345818858
eggNOG 1 0.900 E1_2CMF4
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006132
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.790

Return to query results.
Submit another query.