DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17666 and AT4G16380

Sequence 1:NP_648599.1 Gene:CG17666 FlyBaseID:FBgn0036311 Length:872 Species:Drosophila melanogaster
Sequence 2:NP_001329947.1 Gene:AT4G16380 AraportID:AT4G16380 Length:261 Species:Arabidopsis thaliana

Alignment Length:260 Identity:58/261 (22%)
Similarity:77/261 (30%) Gaps:97/261 (37%)


  Fly   560 CPPEE------NVNSGKKKTQEKNCLELLSRLTESCPPCDLQKWCHLLMPKDKDKSKKQAKPSA- 617
            |.||.      :...|..||     :|::.      ||...|.     .|:...:..|.|:|.| 
plant    63 CSPERIMDKLCSKGGGSIKT-----IEIVE------PPKPPQP-----QPQQPPQKPKDAQPKAP 111

  Fly   618 KKNKKSNGSKVKNKMSEHSSNEIEGTVASPQETPEDEDAHCPCNCKKPCPTPPTKEMRTCGCSAN 682
            :|.|:....|...|:.|            |::..:.|....|...|:|.|.|         ..|.
plant   112 EKPKEPEKPKQPEKLKE------------PEKPKQPEKPKEPEKTKQPAPAP---------APAP 155

  Fly   683 LPEENEDPPPAPSNPPPAPSNPPPVPCNHAPAPVN---TCCMPCSNQCPWSWYYNPCTGCYYYCA 744
            .|.....|.|||: |.|||..|.|.|......|..   .||.|         ||:...|      
plant   156 APAAKPAPAPAPA-PAPAPKQPGPPPQAIPMMPQGQPAMCCGP---------YYDGYGG------ 204

  Fly   745 NCCNGCRNCCNYCCSPCGCCCSNSPAAQLEKIPPKPKQKERQDRSSNSTRNSGGTAVSLGSCAPP 809
                                    ||.....:||:|     .:........|.|     |.|.||
plant   205 ------------------------PAFNGYGMPPQP-----YECYGRPVYESWG-----GGCPPP 235

  Fly   810  809
            plant   236  235

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17666NP_648599.1 Med15 141..>533 CDD:255446
AT4G16380NP_001329947.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_170220
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.