DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17666 and F29D10.2

DIOPT Version :9

Sequence 1:NP_648599.1 Gene:CG17666 / 39452 FlyBaseID:FBgn0036311 Length:872 Species:Drosophila melanogaster
Sequence 2:NP_492391.2 Gene:F29D10.2 / 185118 WormBaseID:WBGene00009251 Length:149 Species:Caenorhabditis elegans


Alignment Length:47 Identity:18/47 - (38%)
Similarity:19/47 - (40%) Gaps:10/47 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   719 CCMPCSNQCPWSWYYNPCTGCYYYCANCCNGCRNCCNYCCSPCGCCC 765
            ||..|..:|        |..|...|  ||..|..||..||..|||.|
 Worm    73 CCCCCRPKC--------CCTCCRTC--CCTRCCTCCRPCCCGCGCGC 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17666NP_648599.1 Med15 141..>533 CDD:255446
F29D10.2NP_492391.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.