powered by:
Protein Alignment CG17666 and F29D10.2
DIOPT Version :9
Sequence 1: | NP_648599.1 |
Gene: | CG17666 / 39452 |
FlyBaseID: | FBgn0036311 |
Length: | 872 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_492391.2 |
Gene: | F29D10.2 / 185118 |
WormBaseID: | WBGene00009251 |
Length: | 149 |
Species: | Caenorhabditis elegans |
Alignment Length: | 47 |
Identity: | 18/47 - (38%) |
Similarity: | 19/47 - (40%) |
Gaps: | 10/47 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 719 CCMPCSNQCPWSWYYNPCTGCYYYCANCCNGCRNCCNYCCSPCGCCC 765
||..|..:| |..|...| ||..|..||..||..|||.|
Worm 73 CCCCCRPKC--------CCTCCRTC--CCTRCCTCCRPCCCGCGCGC 109
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG17666 | NP_648599.1 |
Med15 |
141..>533 |
CDD:255446 |
|
F29D10.2 | NP_492391.2 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
1 | 0.960 |
|
Return to query results.
Submit another query.