DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17666 and C04G6.7

Sequence 1:NP_648599.1 Gene:CG17666 FlyBaseID:FBgn0036311 Length:872 Species:Drosophila melanogaster
Sequence 2:NP_494943.1 Gene:C04G6.7 WormBaseID:WBGene00015457 Length:197 Species:Caenorhabditis elegans

Alignment Length:229 Identity:52/230 (23%)
Similarity:69/230 (30%) Gaps:80/230 (35%)


  Fly   626 SKVKNKMSEHSSNEI-------EGTVASPQETPED--------EDAHCP-CNCKKPCPTPPTKEM 674
            |:|::.:...||.|:       :.:..|..||..|        ....|. |.|...|        
 Worm    18 SQVQSAVLPVSSKEVALVTSSTDASTTSSSETSIDTLGSSRVKRQGGCGCCGCGCGC-------- 74

  Fly   675 RTCGCSANLPEENEDPPPAPSNPPPAPSNPPPVPCNHAPAPVNTCCMP----CSNQCPWSWYYNP 735
              |||.                     .......|        .||.|    |..:|        
 Worm    75 --CGCG---------------------GGGGGCGC--------CCCRPRCCCCCRRC-------- 100

  Fly   736 CTGCYYYCANCCNGCRNCCNYCCSPCGC-CCSNSPAAQLEK----IPPKP---KQKERQDRSSNS 792
            || |...|  ||..|..||..||..||| ||.........|    ..|||   ::.::|:.....
 Worm   101 CT-CCRTC--CCTRCCTCCRPCCCGCGCGCCGCGGGGHFLKSTAMARPKPLIEEKAKKQENDEKK 162

  Fly   793 TRNSGGTAVSLGSC-APPSTFAPWKCPRQEVSTM 825
            .|.:......|.|. .....||.:.. |||:.|:
 Worm   163 NREASRNCCDLASVEVRRPNFADYNY-RQELPTI 195

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17666NP_648599.1 Med15 141..>533 CDD:255446
C04G6.7NP_494943.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
10.960

Return to query results.
Submit another query.