DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hip1 and SLA2

Sequence 1:NP_648597.2 Gene:Hip1 FlyBaseID:FBgn0036309 Length:1124 Species:Drosophila melanogaster
Sequence 2:NP_014156.2 Gene:SLA2 SGDID:S000005187 Length:968 Species:Saccharomyces cerevisiae

Alignment Length:1175 Identity:248/1176 (21%)
Similarity:472/1176 (40%) Gaps:279/1176 (24%)


  Fly    12 LNVSVSKALNGLEAPLKTKHARSIIIMIHKAKEAKTFWMIISRQPLMQSRFTAWKFSHLLHKVLR 76
            |..::.||.:..|...|.||.|:.|:.....:.:|..:..:...||.......:|...:|||:::
Yeast     8 LQKALKKACSVEETAPKRKHVRACIVYTWDHQSSKAVFTTLKTLPLANDEVQLFKMLIVLHKIIQ 72

  Fly    77 EGHESAIRHSQSHKKMILEVGKM--WGLLQDDIGCCIQAYSKLLATKLNFHDKNRMF-PGTLNI- 137
            |||.||:..:...:..|..:|::  .|.....:   |:.|.:.|..||:||..:|.| .||... 
Yeast    73 EGHPSALAEAIRDRDWIRSLGRVHSGGSSYSKL---IREYVRYLVLKLDFHAHHRGFNNGTFEYE 134

  Fly   138 SFTELFIAVDRDLNYCFQLCVEIFDYLEDIIALQLTIFSSMEKYRMSSMTPQGQCRLAPIVCLIQ 202
            .:..|....|.|..|  :..:::....:.:......||:|::..|.::     :|:::.::.||.
Yeast   135 EYVSLVSVSDPDEGY--ETILDLMSLQDSLDEFSQIIFASIQSERRNT-----ECKISALIPLIA 192

  Fly   203 DSNALYDLSVRLMFKLH----DGVPYDVVSGHRDRFHGLFLKLKSFYNNVRPLQYFKDLITIPEL 263
            :|..:|.....::..:|    |......:...::|:.....:|..||.:...::|...|:|||:|
Yeast   193 ESYGIYKFITSMLRAMHRQLNDAEGDAALQPLKERYELQHARLFEFYADCSSVKYLTTLVTIPKL 257

  Fly   264 PDSSPNFKSQNDF------------------------TSYVPPVVHVPQ-EPDPVVEDLVDTNNH 303
            |..:|:....||.                        .:..||||..|. .|.||.:....|...
Yeast   258 PVDAPDVFLINDVDESKEIKFKKREPSVTPARTPARTPTPTPPVVAEPAISPRPVSQRTTSTPTG 322

  Fly   304 ELEAFSQAQQQLSMLEGIISEKEASIEELSFKLDAMQKNFDALQQSYRHDVQELQQNNTVLSNDL 368
            .|:..........|:........|...:.:.:   ||.:|.|.||                    
Yeast   323 YLQTMPTGATTGMMIPTATGAANAIFPQATAQ---MQPDFWANQQ-------------------- 364

  Fly   369 VLAREMCATFRMQNDDLEMQLNQNPILLQKAMEEEEKHKLSSEKFNKLKTLYTKIRDEHIQLLRE 433
                   |.|..:.:.||          |:.:::.::.:...|.|.:             ||.:.
Yeast   365 -------AQFANEQNRLE----------QERVQQLQQQQAQQELFQQ-------------QLQKA 399

  Fly   434 QSD-CNKSLNKEKQVNSQLLLETKELTNEISKIKVNVEEKEKTNLILQKQIEEHKEKIAHLEAVK 497
            |.| .|..|.::.|..:.|:    .|||:.          ||...:||    ::.:::..||:  
Yeast   400 QQDMMNMQLQQQNQHQNDLI----ALTNQY----------EKDQALLQ----QYDQRVQQLES-- 444

  Fly   498 NEMKEKFDDVVKQKEIQELDIISTSENLRLNCLKVEELNGNLNDTLEKLSNAESQINAKTEDIEK 562
                          ||..:|  ||:.                    ::|:|.:.|:.|..:.::.
Yeast   445 --------------EITTMD--STAS--------------------KQLANKDEQLTALQDQLDV 473

  Fly   563 MLKAFEAEKALLLTQIEQQSVESKSHSEAQNAQLQEIMDNLEQKDKEFNEVKLQLSSAESQISLK 627
            ..:.:|: .|.|.:|:.|:.:                  ||..:   |.:::|:::||:..|..|
Yeast   474 WERKYES-LAKLYSQLRQEHL------------------NLLPR---FKKLQLKVNSAQESIQKK 516

  Fly   628 ALEIQNNLKAFEAEKSVLLTKIEQLGIEHK---NNSEAQNAQLQLTLNNLEQN----------ES 679
            . ::::.||..:.:.:.|:...::..:|.:   ||:||.:|........:.|:          ||
Yeast   517 E-QLEHKLKQKDLQMAELVKDRDRARLELERSINNAEADSAAATAAAETMTQDKMNPILDAILES 580

  Fly   680 ALQQTQEIVNQLRQENASAGQRNEDLQSKLSLTEVKLTQATQQIDAVTSSYQICSTDLSELRKLV 744
            .:...||.|              .:|.|.||.:. .||..|..:..:.|:.:..:...:....|:
Yeast   581 GINTIQESV--------------YNLDSPLSWSG-PLTPPTFLLSLLESTSENATEFATSFNNLI 630

  Fly   745 IKTVKEICNSKLSGSEQQPLDAVPNIIREMETILNKFNNASAINYVASTEGLQNVMYLGYVFIKL 809
            :       :....|.:.:.:..|.:....|.|::.. :.|.|:                      
Yeast   631 V-------DGLAHGDQTEVIHCVSDFSTSMATLVTN-SKAYAV---------------------- 665

  Fly   810 YDQCDVIYKTTTAIETGQEIFSKTNLLCTDICQLFQYLLN---NETKEPERQKTI----TDIQTK 867
                     ||...|...:|.:.......:....|:.|::   |:..:.|:...:    .|:|.|
Yeast   666 ---------TTLPQEQSDQILTLVKRCAREAQYFFEDLMSENLNQVGDEEKTDIVINANVDMQEK 721

  Fly   868 LRDIEKLIEKIKASFEQKIDLDKLLEIELREMDAAIDDAASKI--TDLLAKAREKDNQTNLEVNG 930
            |:::...||             .||.|:..:.:...:..:..:  .|.:.|:.|   ...::|..
Yeast   722 LQELSLAIE-------------PLLNIQSVKSNKETNPHSELVATADKIVKSSE---HLRVDVPK 770

  Fly   931 KIVDACTTLMECVKALIQKSRLLQHEIVASQKGNASANEFYRRNSQWSDGLISASKSVAKAANYL 995
            .::.....:::.|.||::.:...|:||..:.  :...|:||.:||:|::|||||:|:||.|.|.|
Yeast   771 PLLSLALMIIDAVVALVKAAIQCQNEIATTT--SIPLNQFYLKNSRWTEGLISAAKAVAGATNVL 833

  Fly   996 VEAANKAIESESGKNF---ELIVAAQEIAACTTQMVIASKVKAERNSQKLTDLTKASRSVTQATG 1057
            :..|:|.|.||..:|.   :.|||::|:||.|.|:|.||:||...:|:....|...|:.||.|..
Yeast   834 ITTASKLITSEDNENTSPEQFIVASKEVAASTIQLVAASRVKTSIHSKAQDKLEHCSKDVTDACR 898

  Fly  1058 TL----VATVKDCNSQLEQQSEIELSKLTPSQIKTMEMEIHVKVLEIEQALQMQRLKLSSFRKEH 1118
            :|    :..::|.:|..:||..::.:  :...:||.|||..|::|::||:|...|.:|...|:..
Yeast   899 SLGNHVMGMIEDDHSTSQQQQPLDFT--SEHTLKTAEMEQQVEILKLEQSLSNARKRLGEIRRHA 961

  Fly  1119 YKNAD 1123
            |.|.|
Yeast   962 YYNQD 966

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hip1NP_648597.2 ANTH 9..281 CDD:284961 64/301 (21%)
TMPIT 402..>504 CDD:285135 19/103 (18%)
I_LWEQ 973..1120 CDD:279885 58/154 (38%)
SLA2NP_014156.2 ANTH 7..273 CDD:311541 64/275 (23%)
RILP-like <420..533 CDD:329033 33/188 (18%)
ILWEQ 763..965 CDD:214607 69/206 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C32777396
eggNOG 1 0.900 E1_KOG0980
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 139 1.000 Inparanoid score I1176
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000829
OrthoInspector 1 1.000 T1136012
orthoMCL 1 0.900 OOG5_129034
Panther 1 1.100 LDO PTHR10407
Phylome 1 0.910 0.825 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1344
TreeFam 1 0.960
1211.790

Return to query results.
Submit another query.