DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hip1 and hip1rb

Sequence 1:NP_648597.2 Gene:Hip1 FlyBaseID:FBgn0036309 Length:1124 Species:Drosophila melanogaster
Sequence 2:NP_001077034.2 Gene:hip1rb ZFINID:ZDB-GENE-070209-59 Length:1065 Species:Danio rerio

Alignment Length:1186 Identity:331/1187 (28%)
Similarity:545/1187 (46%) Gaps:257/1187 (22%)


  Fly     5 AEKEFYHLN--VSVSKALNGLEAPLKTKHARSIIIMIHKAKEAKTFWMIISRQPLMQSRFTAWKF 67
            ||:|.:...  .|:|||:|..|.|||.||||.||:..|:.|.|.|||......||..|...:|||
Zfish    22 AEREHFEKQQLSSISKAINSTETPLKEKHARRIILGTHREKGAYTFWSYAVGLPLPSSAILSWKF 86

  Fly    68 SHLLHKVLREGHESAIRHSQSHKKMILEVGKMWGLLQDDIG--CCIQAYSKLLATKLNFHDKNRM 130
            .|:|||:||:||.:.::....|...|.|.|.:|...:|..|  ..:..::|||.||:.||.|:..
Zfish    87 CHVLHKILRDGHRNTLQDCMRHYSDIAETGLLWTNTRDRHGYALLVSLHAKLLCTKIEFHTKHSE 151

  Fly   131 FPGTLNISFTELFIAVDRDLNYCFQLCVEIFDYLEDIIALQLTIFSSMEKYRMSSMTPQGQCRLA 195
            .|.:|.::...|......|:|..|||.||:|||::..:.|...:...:......|....|||:||
Zfish   152 IPASLEVTDELLERTAGTDINNVFQLTVEVFDYMDAELRLAEAVLHQLNMSIAISTLTSGQCKLA 216

  Fly   196 PIVCLIQDSNALYDLSVRLMFKLHDGVPYDVVSGHRDRFHGLFLKLKSFYNNVRPLQYFKDLITI 260
            |::.:|||.:.||..:|:|:||||..:|.|.:.|||:|||..|..||:|.|..|.:.|||.||.|
Zfish   217 PLIQVIQDCSHLYHYTVKLLFKLHACLPADTLQGHRERFHDQFHSLKTFLNKARDMLYFKRLIQI 281

  Fly   261 PELPDSSPNFKSQNDFTSYVPPVVHVP----------QEPDPVVE-------------------- 295
            |.||||.|||...:....:|.|:|.:|          .||:|:::                    
Zfish   282 PRLPDSPPNFLRASALAEHVKPMVVIPDEEELEEQEEDEPEPLIDVSEALPVAASQPLQSDIFDQ 346

  Fly   296 ------DLVDTNNHELEAFSQAQQQL-SMLEGIISEKEASIEELSFKLDAMQKNFDALQQSYRHD 353
                  |..|..:.::|...:..:.| :.||.|..|.:..|.:|..::::::...:.        
Zfish   347 AFGPPKDGFDDRDLQIERLKREIELLQAELEKIKGEAQRYITQLKAQINSLEGELEE-------- 403

  Fly   354 VQELQQNNTVLSNDLVLAREMCATFRMQNDDLEMQLNQNPILLQKAMEEEEKHKLSSEKFNKLKT 418
             |.:|:..|::.|: .|..|:.||.|...:...||.|        .:|.|::.:.:..::||||.
Zfish   404 -QRMQKQRTLVENE-QLRMELEATHRRNTEHESMQTN--------FVETEKRAQATELRYNKLKE 458

  Fly   419 LYTKIRDEHIQLLREQSDCNKSLNKEKQVNSQLLLETKELTNEISKIKVNVEEKEKTNLILQKQI 483
            .:.::...|.:|||:.:|..|.|:..:|.                                |::|
Zfish   459 KHAELVANHAELLRKSADTVKMLSATQQT--------------------------------QEEI 491

  Fly   484 EEHKEKIA-HLEAVKNEMKEKFDDVVKQKEIQELDIISTSENLRLNCLKVEELNGNLNDTLEKLS 547
            |..|:::| .::.||.|...|||:       |:.:                         ::|| 
Zfish   492 ERTKQQLAFEVDRVKQESDMKFDE-------QKFE-------------------------MDKL- 523

  Fly   548 NAESQINAKTEDIEKMLKAFEAEKALLLTQIEQQSVESKSHSEAQNAQLQEIMDNLEQKDKEFNE 612
              :.::.||..:|:|:..:.:..        |...|...|...|..|:...:..::.:||.|.:.
Zfish   524 --KRELEAKAAEIQKVRSSLQTS--------EMTGVHMNSSMAALQAEKDRLTQSISKKDAELSS 578

  Fly   613 VKLQLSSAESQISLKALEIQNNLKAFEAEKSVLLTKIEQLGIEHKNNSEAQNAQLQLTLNNLEQN 677
            :|     .|||:...:|:                                            ::.
Zfish   579 LK-----KESQLKESSLQ--------------------------------------------QER 594

  Fly   678 ESALQQTQEIVNQLRQENASAGQRNEDLQSKLSLTEVKLTQATQQIDAVTSSYQI---------- 732
            :..:::.:|:..:|:::.:    |.|.||.||...:..|.|||     ||.:..|          
Zfish   595 DRTIRELEELQGKLKEKLS----REEQLQQKLLDEQFTLLQAT-----VTEAENIIQDAVAKLDD 650

  Fly   733 -----CSTDLSELRKLVIKTVKEICNSKLSGSEQ-QPLDAVPNIIREM--------ETILNKFNN 783
                 ||:....|......|:..:...:...||. :.:.....::|.:        :||:    |
Zfish   651 PIHISCSSSPDYLISRAEATLGSVEKVQAGHSEYVKSMKDAGGLVRALTMFSHLAADTII----N 711

  Fly   784 ASAINYVASTEGLQNVMYLGYVFIKLYDQCDVIYKTTTAIETGQEIFSKTNLLCTDICQLFQYLL 848
            .||..::|.|:...          :|.:||.                     .|.  .|..|||.
Zfish   712 GSATAHMAPTDHAD----------RLTEQCK---------------------SCA--TQSLQYLK 743

  Fly   849 NNETKEPERQKTITDIQTKLRDIEKLIEKI--KASFEQKIDLDKLLEIELREMDAAIDDAASKIT 911
            :.::|...|....|.||..::.|.::.:.:  |.....|.:|..:::.|:....|||::|..:|.
Zfish   744 SLKSKASLRGADPTAIQAAVQKILRIGKDLRPKGLDVGKDELGDMVDKEMAATSAAIEEAVRRID 808

  Fly   912 DLLAKAREKDNQTNLEVNGKIVDACTTLMECVKALIQKSRLLQHEIVASQKGNASANEFYRRNSQ 976
            :::::.|:......||||.:|:::||.||:.::.|:..|..||.|||...:|.||..|||.|||:
Zfish   809 EMMSQTRKDATGVQLEVNERILNSCTDLMQAIRLLVLASTDLQKEIVEGGRGAASVREFYARNSR 873

  Fly   977 WSDGLISASKSVAKAANYLVEAANKAIESESGKNFELIVAAQEIAACTTQMVIASKVKAERNSQK 1041
            |::|||||||:|...|..:|::|:|.: ..:||..||||.:.||||.|.|:|.||||||:|.|::
Zfish   874 WTEGLISASKAVGWGATQMVDSADKVV-LHTGKYEELIVCSHEIAASTAQLVAASKVKADRGSKR 937

  Fly  1042 LTDLTKASRSVTQATGTLVATVKDCNSQLEQQSEIELSKLTPSQIKTMEMEIHVKVLEIEQALQM 1106
            |.:|.:|||.|.:....:||:.|....|:|.:..::.|.|:..::|..|||..|||||:|..|:.
Zfish   938 LGNLQQASRHVNEMAAKVVASTKTGQDQVEDKDTMDFSGLSLIKLKKEEMESQVKVLELETMLEN 1002

  Fly  1107 QRLKLSSFRKEHYKNA 1122
            :||:|...||:||:.|
Zfish  1003 ERLRLGELRKKHYEIA 1018

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hip1NP_648597.2 ANTH 9..281 CDD:284961 111/276 (40%)
TMPIT 402..>504 CDD:285135 22/103 (21%)
I_LWEQ 973..1120 CDD:279885 68/147 (46%)
hip1rbNP_001077034.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C32710313
eggNOG 1 0.900 E1_KOG0980
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D104219at2759
OrthoFinder 1 1.000 FOG0000829
OrthoInspector 1 1.000 T596992
orthoMCL 1 0.900 OOG5_129034
Panther 1 1.100 O PTHR10407
Phylome 1 0.910 0.764 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
109.720

Return to query results.
Submit another query.