DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hip1 and HIP1

Sequence 1:NP_648597.2 Gene:Hip1 FlyBaseID:FBgn0036309 Length:1124 Species:Drosophila melanogaster
Sequence 2:NP_005329.3 Gene:HIP1 HGNCID:4913 Length:1037 Species:Homo sapiens

Alignment Length:1159 Identity:345/1160 (30%)
Similarity:552/1160 (48%) Gaps:218/1160 (19%)


  Fly     5 AEKEFYH--LNVSVSKALNGLEAPLKTKHARSIIIMIHKAKEAKTFWMIISRQPLMQSRFTAWKF 67
            ||:|.:.  ..||::||:|..|..:|.||||:.|:..|..|.|:|||.:::|.||..:....|||
Human    31 AERESFERTQTVSINKAINTQEVAVKEKHARTCILGTHHEKGAQTFWSVVNRLPLSSNAVLCWKF 95

  Fly    68 SHLLHKVLREGHESAIRHSQSHKKMILEVGKMWGLLQDDIGCCIQAYSKLLATKLNFHDKNRMFP 132
            .|:.||:||:||.:.::.|..::..:.::.:|||.|.:..|.....|.|||.||:.:|.||..||
Human    96 CHVFHKLLRDGHPNVLKDSLRYRNELSDMSRMWGHLSEGYGQLCSIYLKLLRTKMEYHTKNPRFP 160

  Fly   133 GTLNISFTELFIAVDRDLNYCFQLCVEIFDYLEDIIALQLTIFSSMEKYRMSSMTPQGQCRLAPI 197
            |.|.:|..:|..|.:.|:|..|||.||:|||||..:.|..|:|:|::..|..|:|..|||||||:
Human   161 GNLQMSDRQLDEAGESDVNNFFQLTVEMFDYLECELNLFQTVFNSLDMSRSVSVTAAGQCRLAPL 225

  Fly   198 VCLIQDSNALYDLSVRLMFKLHDGVPYDVVSGHRDRFHGLFLKLKSFYNNVRPLQYFKDLITIPE 262
            :.:|.|.:.|||.:|:|:||||..:|.|.:.||||||...|.|||..:.....|||||.||.||:
Human   226 IQVILDCSHLYDYTVKLLFKLHSCLPADTLQGHRDRFMEQFTKLKDLFYRSSNLQYFKRLIQIPQ 290

  Fly   263 LPDSSPNFKSQNDFTSYVPPVVHVPQE---PD--PVVE--DLVDTNNHEL------------EAF 308
            ||::.|||...:..:.::.|||.:|.|   ||  ||:|  ||:|.:..:.            .:|
Human   291 LPENPPNFLRASALSEHISPVVVIPAEASSPDSEPVLEKDDLMDMDASQQNLFDNKFDDIFGSSF 355

  Fly   309 SQAQQQLSMLEGI-ISEKEASIEELSFKLDAMQKNFDALQQSYRHDVQELQQNNTVLSNDLV--- 369
            |......:...|: ..||:..||.|..::..::...:.::...:..|.:|:.:.:.|..||.   
Human   356 SSDPFNFNSQNGVNKDEKDHLIERLYREISGLKAQLENMKTESQRVVLQLKGHVSELEADLAEQQ 420

  Fly   370 ----LAREMCATFRMQNDDLEMQLNQNPILLQKAMEEEEKHKLSSEKFNKLKTLYTKIRDEHIQL 430
                .|.:.|...|.:.|:|..|........:...|.|.|.:.:.::::|||..|:::...|..|
Human   421 HLRQQAADDCEFLRAELDELRRQREDTEKAQRSLSEIERKAQANEQRYSKLKEKYSELVQNHADL 485

  Fly   431 LREQSDCNKSLNKEKQVNSQLLLETKELTNEISKIKVNVEEKEKTNLILQKQIEEHKEKIAHLEA 495
            ||:.::..|.::..:|....|..|.|||.:.:.:|....:.|      .|:|:|.       ||:
Human   486 LRKNAEVTKQVSMARQAQVDLEREKKELEDSLERISDQGQRK------TQEQLEV-------LES 537

  Fly   496 VKNEMKEKFDDVVKQKEIQELDIISTSENLRLNCLKVEELNGNLNDTLEKLSNAESQINAKTEDI 560
            :|.|:      ...|:|:|.                       |..:||..:.:|:...|:..::
Human   538 LKQEL------ATSQRELQV-----------------------LQGSLETSAQSEANWAAEFAEL 573

  Fly   561 EKMLKAFEAEKALLLTQIEQQS-VESKSHSEAQNAQLQEIMDNLEQKDKEFNEVKLQLSSAESQI 624
            ||                |:.| |...:|.|.:.:.|:          ||..:.:|:|:|.|..:
Human   574 EK----------------ERDSLVSGAAHREEELSALR----------KELQDTQLKLASTEESM 612

  Fly   625 SLKALEIQNNLKAFEAEKSVLLTKIEQLGIEHKNNSEAQNAQLQLTLNNLEQNESALQQTQEIVN 689
            ...|.:          ::.:||                           :...::|.|..|:.:|
Human   613 CQLAKD----------QRKMLL---------------------------VGSRKAAEQVIQDALN 640

  Fly   690 QLRQEN--ASAGQRNEDLQSKLSLTEVKLTQATQQIDAVTSSYQICSTDLSELRKLVIKTVKEIC 752
            ||.:..  :.||..:.     |..|...::...:|::...|.|..|..|:|.|.. .|..:..:.
Human   641 QLEEPPLISCAGSADH-----LLSTVTSISSCIEQLEKSWSQYLACPEDISGLLH-SITLLAHLT 699

  Fly   753 NSKLSGSEQQPLDAVPNIIREMETILNKFNNASAINYVASTEGLQNVMYLGYVFIKLYDQCDVIY 817
            :..::......|.|.|.....:.....::.. ..:.|:||.|                       
Human   700 SDAIAHGATTCLRAPPEPADSLTEACKQYGR-ETLAYLASLE----------------------- 740

  Fly   818 KTTTAIETGQEIFSKTNLLCTDICQLFQYLLNNETKEPERQKTITDIQTKLRDIEKLIEKIKASF 882
                  |.|.                    |.|..            .|.:|:   .:.||||..
Human   741 ------EEGS--------------------LENAD------------STAMRN---CLSKIKAIG 764

  Fly   883 EQKI---------DLDKLLEIELREMDAAIDDAASKITDLLAKAREKDNQTNLEVNGKIVDACTT 938
            |:.:         :|..|::.|:....|||:.|.::|.::|:|:|..|....||||.:|:..||:
Human   765 EELLPRGLDIKQEELGDLVDKEMAATSAAIETATARIEEMLSKSRAGDTGVKLEVNERILGCCTS 829

  Fly   939 LMECVKALIQKSRLLQHEIVASQKGNASANEFYRRNSQWSDGLISASKSVAKAANYLVEAANKAI 1003
            ||:.::.||..|:.||.|||.|.:|.||..|||.:||:|::|||||||:|...|..:|:||:..:
Human   830 LMQAIQVLIVASKDLQREIVESGRGTASPKEFYAKNSRWTEGLISASKAVGWGATVMVDAADLVV 894

  Fly  1004 ESESGKNFELIVAAQEIAACTTQMVIASKVKAERNSQKLTDLTKASRSVTQATGTLVATVKDCNS 1068
            :.. ||..||:|.:.||||.|.|:|.||||||:::|..|..|.:|||.|.|||..:||:.....|
Human   895 QGR-GKFEELMVCSHEIAASTAQLVAASKVKADKDSPNLAQLQQASRGVNQATAGVVASTISGKS 958

  Fly  1069 QLEQQSEIELSKLTPSQIKTMEMEIHVKVLEIEQALQMQRLKLSSFRKEHYKNA 1122
            |:|:...::.|.:|.:|||..||:..|:|||:|..||.:|.||...||:||:.|
Human   959 QIEETDNMDFSSMTLTQIKRQEMDSQVRVLELENELQKERQKLGELRKKHYELA 1012

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hip1NP_648597.2 ANTH 9..281 CDD:284961 116/274 (42%)
TMPIT 402..>504 CDD:285135 26/102 (25%)
I_LWEQ 973..1120 CDD:279885 69/147 (47%)
HIP1NP_005329.3 ANTH 39..308 CDD:311541 116/269 (43%)
SMC_N <369..644 CDD:330553 74/380 (19%)
pDED 410..491 20/81 (25%)
HIP1_clath_bdg 482..580 CDD:318670 32/156 (21%)
ILWEQ 814..1012 CDD:214607 93/199 (47%)
Important for actin binding. {ECO:0000250} 867..924 29/58 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C32718386
eggNOG 1 0.900 E1_KOG0980
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 426 1.000 Inparanoid score I1730
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D104219at2759
OrthoFinder 1 1.000 FOG0000829
OrthoInspector 1 1.000 T609383
orthoMCL 1 0.900 OOG5_129034
Panther 1 1.100 LDO PTHR10407
Phylome 1 0.910 0.790 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1344
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1211.800

Return to query results.
Submit another query.