DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hip1 and Hip1r

Sequence 1:NP_648597.2 Gene:Hip1 FlyBaseID:FBgn0036309 Length:1124 Species:Drosophila melanogaster
Sequence 2:NP_659507.3 Gene:Hip1r MGIID:1352504 Length:1068 Species:Mus musculus

Alignment Length:1187 Identity:346/1188 (29%)
Similarity:550/1188 (46%) Gaps:271/1188 (23%)


  Fly     5 AEKEFYHLN--VSVSKALNGLEAPLKTKHARSIIIMIHKAKEAKTFWMIISRQPLMQSRFTAWKF 67
            ||:|.:...  :|:|||:|..|||:|.||||.||:..|..|.|.|||......||..|...:|||
Mouse    22 AEREQFDKTQAISISKAINSQEAPVKEKHARRIILGTHHEKGAFTFWSYAIGLPLSSSSILSWKF 86

  Fly    68 SHLLHKVLREGHESAIRHSQSHKKMILEVGKMWGLLQDDIGCCIQAYSKLLATKLNFHDKNRMFP 132
            .|:||||||:||.:.:...|.::..|.|:|.:||.|:|..|..:..|:|||.||::||.|:..||
Mouse    87 CHVLHKVLRDGHPNVLHDYQRYRSNIREIGDLWGHLRDQYGHLVNIYTKLLLTKISFHLKHPQFP 151

  Fly   133 GTLNISFTELFIAVDRDLNYCFQLCVEIFDYLEDIIALQLTIFSSMEKYRMSSMTPQGQCRLAPI 197
            ..|.::...|..|...|:|..|||.||:|||::..:.|..::|..:......|....|||||||:
Mouse   152 AGLEVTDEVLEKAAGTDVNNIFQLTVEMFDYMDCELKLSESVFRQLNTAIAVSQMSSGQCRLAPL 216

  Fly   198 VCLIQDSNALYDLSVRLMFKLHDGVPYDVVSGHRDRFHGLFLKLKSFYNNVRPLQYFKDLITIPE 262
            :.:|||.:.||..:|:||||||..:|.|.:.|||||||..|..||:|:.....:.|||.||.||.
Mouse   217 IQVIQDCSHLYHYTVKLMFKLHSCLPADTLQGHRDRFHEQFHSLKNFFRRASDMLYFKRLIQIPR 281

  Fly   263 LPDSSPNFKSQNDFTSYVPPVVHVPQEP-------------------DPVV-------------- 294
            ||:..|||...:....::.|||.:|:|.                   :|||              
Mouse   282 LPEGPPNFLRASALAEHIKPVVVIPEEAPEEEEPENLIEISSAPPAGEPVVVADLFDQTFGPPNG 346

  Fly   295 ----------EDL---VDTNNHELEAFS-QAQQQLSMLEGIISEKEASIEELSFKLDAMQKNFDA 345
                      |:|   |:|...|||... :||:.:|.|:|.::..||.:||              
Mouse   347 SMKDDRDLQIENLKREVETLRAELEKIKMEAQRYISQLKGQVNGLEAELEE-------------- 397

  Fly   346 LQQSYRHDVQELQQNNTVLSNDLVLAREMCATFRMQNDDLEMQLNQNPILLQKAMEEEEKHKLSS 410
                     |..|:...::.|: .|..|:.....:|   ||...||       .:.||.:.|.|:
Mouse   398 ---------QRKQKQKALVDNE-QLRHELAQLKALQ---LEGARNQ-------GLREEAERKASA 442

  Fly   411 --EKFNKLKTLYTKIRDEHIQLLREQSDCNKSLNKEKQVNSQLLLETKELTNEISKIKVNVEEKE 473
              .:::|||..::::.:.|.:|||:.:|..|.|...:|                           
Mouse   443 TEARYSKLKEKHSELINTHAELLRKNADTAKQLTVTQQ--------------------------- 480

  Fly   474 KTNLILQKQIEEHKEKIA-HLEAVKNEMKEKFDDVVKQKEIQELDIISTSENLRLNCLKVEELNG 537
                 .|:::...||::| .:|..|.|.:                            :|:||   
Mouse   481 -----SQEEVARVKEQLAFQMEQAKRESE----------------------------MKMEE--- 509

  Fly   538 NLNDTLEKLSNAESQINAKTEDIEKMLKAFEAEKALLLTQIEQQSVESKSHSEAQNAQLQEIMDN 602
             .:|.||||   :.::.|:..::.:..:|        |::.||...|..|..:..||:.:.:...
Mouse   510 -QSDQLEKL---KRELAARAGELARAQEA--------LSRTEQSGSELSSRLDTLNAEKEALSGV 562

  Fly   603 LEQKDKEFNEVKLQLSSAESQISLKALEIQNNLKAFEAEKSVLLTKIEQLGIEHKNNSEAQNAQL 667
            :.|::.|                            ..|.:|::..|.|.|..|.:.:|: :..:|
Mouse   563 VRQREAE----------------------------LLAAQSLVREKEEALSQEQQRSSQ-EKGEL 598

  Fly   668 QLTLNNLEQNESALQQ--TQEIVNQLRQENASAGQRNEDLQSKL---------SLTEVKLTQATQ 721
            :..|...|..|..|:|  ..|.:..||...|.|....:|..|||         |..:..:::|..
Mouse   599 RGQLAEKESQEQGLRQKLLDEQLAVLRSAAAEAEAILQDAVSKLDDPLHLRCTSSPDYLVSRAQA 663

  Fly   722 QIDAVT------SSYQICSTDLSELRKLVIKTVKEICNSKLSGSEQQPLDAVPNIIREMETILNK 780
            .:|:|:      :.|...|.|.|.|                          |..:.|......:.
Mouse   664 ALDSVSGLEQGHTQYLASSEDASAL--------------------------VAALTRFSHLAADT 702

  Fly   781 FNNASAINYVASTEGLQNVMYLGYVFIKLYDQCDVIYKTTTAIE-TGQEIFSKTNLLCTDICQLF 844
            ..|.:|.:::|.|:....:|          |.|...  ...|:| .||                 
Mouse   703 IVNGAATSHLAPTDPADRLM----------DTCREC--GARALELVGQ----------------- 738

  Fly   845 QYLLNNETKEPERQKTITDIQTKLRDIEKLIEKIK-ASFE-QKIDLDKLLEIELREMDAAIDDAA 907
               |.::|..|..|.::  ::..|:.|.:|.:.:| .|.: ::.:|..:::.|:....|||:||.
Mouse   739 ---LQDQTVLPRAQPSL--MRAPLQGILQLGQDLKPKSLDVRQEELGAMVDKEMAATSAAIEDAV 798

  Fly   908 SKITDLLAKAREKDNQTNLEVNGKIVDACTTLMECVKALIQKSRLLQHEIVASQKGNASANEFYR 972
            .:|.|::::||.:.:...||||.:|:::||.||:.::.|:..|..||.|||.|.:|.|:..|||.
Mouse   799 RRIEDMMSQARHESSGVKLEVNERILNSCTDLMKAIRLLVMTSTSLQKEIVESGRGAATQQEFYA 863

  Fly   973 RNSQWSDGLISASKSVAKAANYLVEAANKAIESESGKNFELIVAAQEIAACTTQMVIASKVKAER 1037
            :||:|::|||||||:|...|..|||:|:|.: ...||..||||.:.||||.|.|:|.||||||.:
Mouse   864 KNSRWTEGLISASKAVGWGATQLVESADKVV-LHMGKYEELIVCSHEIAASTAQLVAASKVKANK 927

  Fly  1038 NSQKLTDLTKASRSVTQATGTLVATVKDCNSQLEQQSEIELSKLTPSQIKTMEMEIHVKVLEIEQ 1102
            ||..|:.|.:.||:|.:....:||:.|....|:|.:..::.|.|:..::|..|||..|:|||:|:
Mouse   928 NSPHLSRLQECSRTVNERAANVVASTKSGQEQIEDRDTMDFSGLSLIKLKKQEMETQVRVLELEK 992

  Fly  1103 ALQMQRLKLSSFRKEHY 1119
            .|:.:|::|...||:||
Mouse   993 TLEAERVRLGELRKQHY 1009

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hip1NP_648597.2 ANTH 9..281 CDD:284961 116/274 (42%)
TMPIT 402..>504 CDD:285135 22/105 (21%)
I_LWEQ 973..1120 CDD:279885 66/148 (45%)
Hip1rNP_659507.3 ANTH 28..300 CDD:284961 116/272 (43%)
Taxilin 357..613 CDD:286771 79/394 (20%)
RILP-like <362..470 CDD:304877 35/142 (25%)
HIP1_clath_bdg 461..559 CDD:293123 32/173 (18%)
ILWEQ 814..1012 CDD:214607 88/198 (44%)
Important for actin binding. {ECO:0000250} 867..924 32/58 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C32704841
eggNOG 1 0.900 E1_KOG0980
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 427 1.000 Inparanoid score I1721
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D104219at2759
OrthoFinder 1 1.000 FOG0000829
OrthoInspector 1 1.000 T616197
orthoMCL 1 0.900 OOG5_129034
Panther 1 1.100 O PTHR10407
Phylome 1 0.910 0.796 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1344
TreeFam 1 0.960
1211.800

Return to query results.
Submit another query.